HomeMy WebLinkAbout2011-08-02-Meeting AgendaCommissionMeetingAgenda
CommissionChamber
8/2/2011
5:00PM
INVOCATION:Fr.ScottWinchel,ParochialVicar,St.MaryOnTh eHillCatholicChurch.
PLEDGEOFALLEGIANCETOTHEFLAGOFTHEUNITEDSTAT ESOFAMERICA.
Five(5)minutetimelimitperdelegation
DELEGATIONS
A.Mr.DonaldD'Antignac.RE:ConcernswiththeAdmi nistrator.Attachments
CONSENTAGENDA
(Items1-18)
PLANNING
1.ZA-R-208–A request for concurrence with the Augusta Planning
Commissionto approveapetitiontoamendSection2(Definitions)of
theComprehensiveZoningOrdinanceforAugusta,Geo rgiabyaddinga
definitionforalcoholdrinkingestablishmentsorn ightclubs.(Approved
bytheCommissionJuly19,2011-secondreading)
Attachments
2.ZA-R-209–A request for concurrence with the Augusta Planning
Commission to approvea petition to amend Section 22 (General
Business)oftheComprehensiveZoningOrdinanceforAugusta,Georgia
thereby conforming with changes that were made to S ection 21
(Neighborhood Business)relative to permitting cafes, restaurants,
tavernsanddrinkingestablishmentsaspermittedus es.(Approvedby
theCommissionJuly19,2011-secondreading)
Attachments
PUBLICSERVICES
3.Motion to approvearequestfrom Mobility TransitServices,LLCto
amend the transit management agreement to provide f ora semi-
monthlypaymentscheduleandtoallowMobilitytot akeadvantageof
andallowAugustatorealizethebenefitsofmainta iningAugusta’sbulk
fuelpurchasingpower.(ApprovedbyPublicServicesCommitteeJuly
25,2011)
Attachments
4.Motionto approvetaskingtheAdministratorandLawDepartmentto
work on developing a Comprehensive No SmokingOrdin ance for
Richmond County and to schedule pubilc hearings to receive public
input.(ApprovedbyPublicServicesCommitteeJuly25,201 1)
Attachments
ADMINISTRATIVESERVICES
5.Motionto approveanOrdinancetoamendtheAugusta,GA.CodeTitle
EightChapterOneArticleOneSections8-1-5throug h8-1-9relatingto
theCreationandDutiesofthePlanningandDevelop mentDepartment;
torepealallCodeSectionsandOrdinancesandpart ofCodeSections
andOrdinancesinconflictherewith;toprovidean effectivedateandfor
otherpurposes.(ApprovedbytheCommissionJuly19,2011-second
reading)
Attachments
6.Motionto approve taskingtheAdministratorandrelatedstafftodeve lop
in thirty days for Commission reviewan RFP and/or RFQ for
asolicitation from professional human resources f irms for an
independentauditandassessment/efficiencystudyo fAugustaRichmond
County Government.(Approved by Administrative Services
CommitteeJuly25,2011)
Attachments
PUBLICSAFETY
7.Motion to approvean Ordinance to Amend the Augusta, GA Code
creatingTitleTwoChapterTwoArticleSixSection 2-2-57Relatingto
Imposinga9-1-1ChargeonPrepaidWirelessService;ToRepealAll
Code Sections and Ordinances in Conflict Herewith;To Provide an
EffectiveDateandforOtherPurposes.(ApprovedbyCommissionJuly
19,2011-secondreading)
Attachments
FINANCE
8.Motion to approveacceptance of EMW-2010-FO-00697, 2010
Assistance to Firefighters Grant Programs award.(Approved by
FinanceCommitteeJuly25,2011)
Attachments
9.Motionto approvethepurchaseof(2)FellingAirTiltTrailersfrom
Bobcat of Augusta, the lowest responsive bid, for t he Environmental
Services Department.(Approved by Finance Committee July 25,
2011)
Attachments
ENGINEERINGSERVICES
10.Motion to authorize Georgia Power Company to proceed with the
necessaryprocurement,undergroundrough-in,andtimelyinstallationof
site lighting for the expansion parking lot. The co st is $124,300.00
including trenching, underground conduit, wiring, i nstallation of
decorativepolesandlightsforthenewparkinglot servingtheJudicial
Center and John H. Ruffin Courthouse.(Approved by Engineering
ServicesCommitteeJuly25,2011)
Attachments
11.Motiontoawardsubjectcontracttothe Allen+BatchelorConstruction
Companyin the amount of $1,173,032.00for the renovations to the
Customer Services Metering Division Building for Au gusta Utilities
Department.(ApprovedbyEngineeringServicesCommitteeJuly25 ,
2011)
Attachments
12.Motionto approvethecontractwithCooksDirect,Inc.intheamount of
$25,849.44forthepurchaseofFoodTraysandFoodCarts(Bid Item
#11-132)fortheCharlesB.WebsterDetentionCenterEx pansion.Thisis
thelowbid.(ApprovedbyEngineeringServicesCommitteeJuly25 ,
2011)
Attachments
13.Motion to approvea request from the Downtown Development
AuthorityfortheCitytomatchaDOTEnhancementG ranttocomplete
theJamesBrownBlvd.StreetscapePhase2withthe Administratorto
recommendif HUDorSPLOST fundingshouldbeusedfortheproject.
(ApprovedbyEngineeringServicesCommitteeJuly25 ,2011)
Attachments
14.Motion to approvea request by Descendants of the Signers of the Attachments
Declaration of Independence Inc. to place a 6" x 9"plaque at the
Signer’s Monument on Greene Street.(Approved by Engineering
ServicesCommitteeJuly25,2011)
15.Motion to approve and authorize Augusta Engineering Department
(AED)toaccepttheproposalfromEMCEngineeringt oprovidedesign
andregulatorypermittingprofessionalservicesfor RockyCreekBasin&
FloodHazardMitigationprojectintheamountof$3 50,000,subjectto
receipt of signed professional services contract.(Approved by
EngineeringServicesCommitteeJuly25,2011)
Attachments
16.Motionto approvetheselectioncommittee’srecommendationtoissuea
contract to Johnson, Laschober & Associates, P.C. f or Professional
Design Services for the New Webster Detention Cente r, Phase II.
(ApprovedbyEngineeringServicesCommitteeJuly25 ,2011)
Attachments
17.Motionto authorizetheEngineeringDepartmenttoapproveCPB#323-
041110-299823786,ChangeNumberNineandSupplementalAgre ement
NumberNinefromJacobsEngineeringGroup,Inc.(JE G)intheamount
of$37,141forthepurposeofpreparinganewNoise Studytocomply
withGDOTGuidelineswhichwentintoeffectJuly13 ,2011;preparean
EcologyAddendumwhichwillincorporatedeterminati onsofwatersof
thestateinaccordancewithanEPDsitevisit;and incorporatethesenew
studies into the environmental document which will have to be re-
evaluatedandapprovedbytheGeorgiaDepartmentof Transportation
(GDOT) and Federal Highway Administration (FHWA) so state and
federal funds can be used to fund the right of way acquisition on
WindsorSpringRoadSectionV,ARCproject.Funds areavailablein
theprojectengineeringaccount.(ApprovedbyEngineeringServices
CommitteeJuly25,2011)
Attachments
PETITIONSANDCOMMUNICATIONS
18.Motion to approvethe minutes of the regular meeting of the
Commissionheld July19,2011and LegalMeetingheld July25,2011 .
Attachments
****ENDCONSENTAGENDA****
AUGUSTACOMMISSION
8/2/2011
AUGUSTACOMMISSION
REGULARAGENDA
8/2/2011
(Items19-27)
PUBLICSERVICES
19.Motionto rescindtheJuly19,2011actionoftheCommissiontoleas e
thefutureoperationsoftheAugustaMunicipalGolf CoursetoThePatch
InAugusta,LLC.(RequestedbyCommissionerCoreyJohnson)
Attachments
ADMINISTRATIVESERVICES
20.Motionto approveanOrdinancetoamendtheAugusta,GACodeTitle
OneChapterTwoArticleThreeSection1-2-36relatingtotheDutiesof
theAdministratorofAugusta,Georgia;torepealal lCodeSectionsand
Ordinances in conflict herewith; to provide an effe ctive date and for
other purposes.(No recommendation from Administrative Services
CommitteeJuly25,2011)
Attachments
21.Motionto approveanOrdinancetoamendtheAugusta,GACodeTitle
OneChapterSevenArticleFourSection1-7-51relatingtotheadoption
of Personnel Policies and Procedures of Augusta, Ge orgia; to
modifyAdministrator's Recommending Authority; to r epeal all Code
SectionsandOrdinancesandpartsofCodeSections andOrdinancesin
conflictherewith;toprovideaneffectivedateand forotherpurposes.
(NorecommendationfromAdministrativeServicesCom mitteeJuly
25,2011)
Attachments
FINANCE
22.Discussand approvetheproposedmillrates(computedrollbackrates)
for2011andproceedtoadvertisetheiradoptionon August4th(proposed
rates),scheduledadoptiondate,andadvertise5y earhistoryofdigestin
theAugusta Chronicle as required by state law; the scheduling of a
10:00 A.M. August 19 10:00 Special Called Meeting t o approve
proposed mill rates as advertised.(Requested by Mayor Deke
Copenhaver)
Attachments
UpcomingMeetings
www.augustaga.gov
APPOINTMENT(S)
23.Appointment of Commission representative to the 201 1 Redistricting
Committee.(RequestedbyMayorCopenhaver)
Attachments
24.Motionto approve therecommendationfromtheCSRAEOAtoappoint
BrendaBonner.
Attachments
25.Motionto approvetherecommendationsofthe(Augusta)Departmentof
Family&ChildrenServicesBoardtoreappointDr.T homasGardiner
andMr.JamesKendrick.
Attachments
26.Motion to approvethe recommendations from the Sheriff's
Departmentto appoint Dan Weigle replacing Russell Malone and
QuincyRobertson replacing DanielCross ,Sr.totheRichmondCounty
Sheriff'sMeritBoard.(RequestedbyCommissionerJoeJackson)
Attachments
LEGALMEETING
A.PendingandPotentialLitigation.
B.RealEstate.
C.Personnel.
27.Motion to authorizeexecution by the Mayor of the affidavit of
compliancewithGeorgia'sOpenMeetingAct.
CommissionMeetingAgenda
8/2/20115:00PM
Invocation
Department:
Caption:Fr.ScottWinchel,ParochialVicar,St.MaryOnThe HillCatholic
Church.
Background:
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 1
CommissionMeetingAgenda
8/2/20115:00PM
DonaldD'Antignac
Department:
Caption:Mr.DonaldD'Antignac.RE:ConcernswiththeAdmi nistrator.
Background:
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 2
Attachment number 1
Page 1 of 1
Item # 2
CommissionMeetingAgenda
8/2/20115:00PM
ZA-R-208
Department:PlanningCommission
Caption:ZA-R-208–ArequestforconcurrencewiththeAugusta
PlanningCommissionto approveapetitiontoamendSection2
(Definitions)oftheComprehensiveZoningOrdinance for
Augusta,Georgiabyaddingadefinitionforalcohol drinking
establishmentsornightclubs.(ApprovedbytheCommission
July19,2011-secondreading)
Background:
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 3
ORDINANCE ______
An Ordinance to amend the Comprehensive Zoning Ordinance adopted by the
Augusta, Georgia Commission effective September 16, 1997 by amending
Section 2 (Definitions)
THE AUGUSTA COMMISSION HEREBY ORDAINS:
SECTIO I. That the Comprehensive Zoning Ordinance is amended by adding the
following to Section 2 (Definitions)
DRIKIG ESTABLISHMETS – drinking establishments (nightclubs) shall be a
building that has a seating capacity of at least 40 persons consistent with Section 6-2-51 of
the Augusta Georgia Code thereby regulating alcohol licenses.
SECTIO II . All Ordinances or parts of Ordinances in conflict with this Ordinance are hereby
repealed.
Duly adopted by the Augusta, Georgia Commission this ______ day of
__________________, 2011.
__________________________________________
MAYOR, AUGUSTA COMMISSION
AUGUSTA, GEORGIA
ATTEST:
________________________________________
LENA BONNER, CLERK
First Reading: ____________________________
Second Reading: __________________________
Attachment number 1
Page 1 of 2
Item # 3
Attachment number 1
Page 2 of 2
Item # 3
CommissionMeetingAgenda
8/2/20115:00PM
ZA-R-209
Department:PlanningCommission
Caption: ZA-R-209–ArequestforconcurrencewiththeAugustaPlanning
Commissionto approveapetitiontoamendSection22 (General
Business)oftheComprehensiveZoningOrdinanceforAugusta,
Georgiatherebyconformingwithchangesthatwerem adeto
Section21 (NeighborhoodBusiness)relativetopermittingcafes,
restaurants,tavernsanddrinkingestablishmentsas permitteduses.
(ApprovedbytheCommissionJuly19,2011-second reading)
Background:
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 4
ORDINANCE ______
An Ordinance to amend the Comprehensive Zoning Ordinance adopted by the
Augusta, Georgia Commission effective September 16, 1997 by amending
Section 22-1 (b) (Permitted Uses)
THE AUGUSTA COMMISSION HEREBY ORDAINS:
SECTIO I. That the Comprehensive Zoning Ordinance is amended by deleting the
following to Section 22-1 (b) (Permitted Uses)
(2) Restaurants, cafes (including dancing and entertainment).
SECTIO II. That the Comprehensive Zoning Ordinance is amended by adding the
following language in Section 22-1 (b) (Permitted Uses)
(2) Cafes, restaurants, taverns and drinking establishments (nightclubs)
SECTIO III . All Ordinances or parts of Ordinances in conflict with this Ordinance are hereby
repealed.
Duly adopted by the Augusta, Georgia Commission this ______ day of
__________________, 2011.
__________________________________________
MAYOR, AUGUSTA COMMISSION
AUGUSTA, GEORGIA
ATTEST:
________________________________________
LENA BONNER, CLERK
First Reading: ____________________________
Second Reading: __________________________
Attachment number 1
Page 1 of 2
Item # 4
Attachment number 1
Page 2 of 2
Item # 4
CommissionMeetingAgenda
8/2/20115:00PM
MobilityTransitManagementAgreementAmendment
Department:Law
Caption:Motionto approvearequestfromMobilityTransitServices,
LLCtoamendthetransitmanagementagreementtopr ovidefora
semi-monthlypaymentscheduleandtoallowMobility totake
advantageofandallowAugustatorealizethebenef itsof
maintainingAugusta’sbulkfuelpurchasingpower.(Approved
byPublicServicesCommitteeJuly25,2011)
Background:UnderthecurrentagreementMobilityisresponsible forproviding
thedieselfuelfortheAPTrevenuevehiclesaswel lasfor
itssupportvehicles,i.e.supervisor’svehicles.
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Finance.
Law.
Administrator.
ClerkofCommission
Cover Memo
Item # 5
1
TRASIT MAAGEMET AGREEMET
BETWEE
AUGUSTA, GEORGIA
AD
MOBILITY TRASIT SERVICES, LLC
DATED: JUE 30, 2011
FIRST AMENDMENT to the Transit Management Agreement (hereinafter
referred to as the “Agreement”) between AUGUSTA, GEORGIA, as a political
subdivision of the State of Georgia (hereinafter referred to as “Augusta, Georgia”), and
MOBILITY TRANSIT SERVICES, LLC, a Florida Limited Liability Company qualified
to do business in the State of Georgia (hereinafter referred to as “Mobility”), entered into
on this _______ day of July, 2011.
WHEREAS, the Parties agree to the following terms and conditions and expressly
agree that if any of the following terms and conditions conflict with any of the terms and
conditions of the Agreement, then, notwithstanding any term in the Agreement, the
following terms and conditions govern and control the rights and obligations of the
parties.
NOW, THEREFORE, in consideration of the Parties agreeing to amend their
obligations in the existing Agreement, and other valuable consideration, the receipt and
sufficiency of which is hereby acknowledged, both Parties agree to amend the Agreement
as follows:
1. SECTION 1.10 PAYMENT FOR FIXED ROUTE, PARATRANSIT
SERVICES, AND RURAL SERVICE of the Agreement is deleted in its entirety and
replaced with the following:
Mobility shall submit a monthly invoice by the 5th calendar day of the month
following each month of service during the term of this Agreement. The invoice shall be
in accordance with the actual number of revenue hours times the agreed to revenue hour
rate for each service type. The terms of payment shall include an interim progress
payment consisting of forty (40%) of the estimated monthly invoice. Mobility will at the
start of the contract year send the Contract Administrator the monthly estimated invoices
for that year. The actual payment date will be in accordance with Augusta, Georgia’s bi-
weekly check writing schedule. Each monthly invoice will include an adjustment for the
interim progress payment made during the month for which the service is being
invoiced. Revenue hours will be as defined in the Agreement. If Revenue Hours
increase or decrease by more than 10%, an equitable adjustment may be made to the
service hourly rate. Additionally, if changes in scheduled service result in increases or
decreases in fixed costs, an equitable adjustment may be made.
Attachment number 1
Page 1 of 3
Item # 5
2
2. EXHIBIT A SECTION 1 PART J of the Operations and Maintenance of Augusta
Public Transit – Scope of Work is deleted in its entirety and replaced with the following:
Augusta, Georgia will provide fuel for APT revenue vehicles. Augusta, Georgia
will outline all operating, administrative, and accounting procedures that Mobility must
follow in connection with fueling operations. Mobility shall pay for the fuel used for
contractor support vehicles, i.e. supervisor’s vehicles.
Contractor Responsibilities:
• Mobility shall be responsible for ordering the fuel by any method approved by
Augusta, Georgia. Fuel shall be ordered in full tanker loads to minimize the per
unit fuel price under the current Contract for Fuel. Invoices will be sent to
Augusta, Georgia for payment.
• Monitor the level of fuel supply and timely order fuel under Augusta, Georgia’s
authorization for Contract fuel purchases, to keep all Revenue Vehicles in full
operation;
• Fuel usage reports shall be submitted by Mobility to Augusta, Georgia on a daily
and monthly basis.
• Mobility will eliminate all fuel costs from their budget.
3. All other terms of the Agreement remain in effect.
This Agreement Amendment is not effective until fully executed by all parties.
[THIS SPACE INTENTIONALLY LEFT BLANK]
[SIGNATURE LINES ON NEXT PAGE]
Attachment number 1
Page 2 of 3
Item # 5
3
IN WITNESS WHEREOF, the parties have executed this Agreement under seal as of the
date first written above.
(SEAL)
Attest:
______________________
Lena J. Bonner,
Clerk of Commission
AUGUSTA, GEORGIA
By:______________________________
Deke S. Copenhaver, Mayor
(SEAL)
Attest:
_______________________
MOBILITY TRANSIT SERVICES, LLC
By:_____________________________
Kevin J. Adams,
President & CEO; Managing Member
Attachment number 1
Page 3 of 3
Item # 5
CommissionMeetingAgenda
8/2/20115:00PM
NoSmokingOrdinance
Department:ClerkofCommission
Caption:Motionto approvetaskingtheAdministratorandLaw
DepartmenttoworkondevelopingaComprehensiveNo
SmokingOrdinanceforRichmondCountyandtoschedu lepubilc
hearingstoreceivepublicinput.(ApprovedbyPublicServices
CommitteeJuly25,2011)
Background:
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 6
Attachment number 1
Page 1 of 14
Item # 6
Attachment number 1
Page 2 of 14
Item # 6
Attachment number 1
Page 3 of 14
Item # 6
Attachment number 1
Page 4 of 14
Item # 6
Attachment number 1
Page 5 of 14
Item # 6
Attachment number 1
Page 6 of 14
Item # 6
Attachment number 1
Page 7 of 14
Item # 6
Attachment number 1
Page 8 of 14
Item # 6
Attachment number 1
Page 9 of 14
Item # 6
Attachment number 1
Page 10 of 14
Item # 6
Attachment number 1
Page 11 of 14
Item # 6
Attachment number 1
Page 12 of 14
Item # 6
Attachment number 1
Page 13 of 14
Item # 6
Attachment number 1
Page 14 of 14
Item # 6
Attachment number 2
Page 1 of 6
Item # 6
Attachment number 2
Page 2 of 6
Item # 6
Attachment number 2
Page 3 of 6
Item # 6
Attachment number 2
Page 4 of 6
Item # 6
Attachment number 2
Page 5 of 6
Item # 6
Attachment number 2
Page 6 of 6
Item # 6
CommissionMeetingAgenda
8/2/20115:00PM
OptionsforoperationofAugustaMunicipalGolfCou rse
Department:Recreation,ParksandFacilitiesDepartment
Caption:Motionto rescindtheJuly19,2011actionoftheCommissionto
leasethefutureoperationsoftheAugustaMunicipa lGolfCourse
toThePatchInAugusta,LLC.(RequestedbyCommissioner
CoreyJohnson)
Background:
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 7
Augusta, GA
Management Agreement
This Management Agreement (“Agreement”) is made and entered into effective this first
day of July, 2011, between Augusta, GA for Augusta Municipal Golf Course (“Owner”),
and Affiniti Golf Partners, Inc., a Georgia corporation (“Affiniti Golf Partners”).
Whereas, Affiniti Golf Partners is engaged in the business of developing, marketing,
maintaining and managing golf facilities; and
Whereas, Owner desires to hire Affiniti Golf Partners as an independent contractor under
the terms and conditions set forth herein to manage and conduct the business and
services of the Owner’s golf facilities to include 18 holes, practice range, clubhouse and
maintenance facility of Augusta Municipal Golf Course and 2 holes, putting green, and
practice range at “The First Tee.”
Now, therefore, in consideration of the mutual promises and covenants contained in this
Agreement, and intending to be legally bound hereby, Owner and Affiniti Golf Partners
agree as follows:
1. Representations and Warranties by Affiniti Golf Partners
Affiniti Golf Partners hereby represents and warrants to Owner as follows:
1.1 Affiniti Golf Partners is a Georgia corporation validly existing and in good
standing with the State of Georgia, and
1.2 Affiniti Golf Partners has the financial ability to enter into and perform its
obligations under this Agreement; and
1.3 Affiniti Golf Partners is not restricted from entering into and performing its
obligations under this Agreement; and
1.4 Affiniti Golf Partners has full power and authority to execute this
Agreement and to be bound by and perform the terms hereof, and the
person executing this Agreement on behalf of Affiniti Golf Partners is duly
authorized to do so and to legally bind Affiniti Golf Partners.
2. Representations and Warranties by Owner
Owner hereby represents and warrants to Affiniti Golf Partners as follows:
2.1 There are no actions, suits or proceedings of any kind or nature
whatsoever, legal or equitable, pending or, to the best of Owner’s
knowledge, threatened against the Facilities or Owner in any court or
before or by any federal, state, county or municipal department,
commission, board, bureau or agency or other governmental
Attachment number 1
Page 1 of 24
Item # 7
instrumentality, including, without limitation, any condemnation or
eminent domain proceedings;
2.2 To the best of Owner’s knowledge, no person, firm, corporation or other
legal entity whatsoever has any right or option whatsoever to acquire or
lease the Facilities or any portion or portions thereof or any interest or
interests therein;
2.3 To the best of Owner’s knowledge, there is no existing violation or breach
of any ordinance, code, law, rule, requirement or regulation applicable to
the Facilities;
2.4 Owner has full power and authority to execute this Agreement and to be
bound by and perform the terms hereof, and the person executing this
Agreement on behalf of Owner is duly authorized to do so and to legally
bind Owner; and
2.5 Owner owns all trade names and logos that it uses in the operation of the
Facilities and, during the Operating Period (as hereinafter defined) no
other party has any right to use such trade names or logos.
3. Appointment of Affiniti Golf Partners
Owner hereby appoints Affiniti Golf Partners as Owner of the Owner’s facilities, subject to
the provisions of this Agreement.
4. Term
The term of this Agreement shall be five (5) years. The services of Affiniti Golf Partners
shall commence on September 1, 2011, (hereinafter the “Effective Date”), and shall
terminate on August 31, 2016, unless sooner terminated as provided hereinafter. Such
period between the Effective Date and the date of termination is hereinafter referred to as
the “Operating Period.” Unless the Owner has notified the Affiniti Golf Partners of its
intention to not renew this Agreement at least 60 days prior to the expiration of the Initial
Term, or any term thereafter, the Term of this Agreement shall automatically renew for an
additional one year term on the same terms and conditions as contained herein.
5. Responsibilities of Owner and Affiniti Golf Partners
5.1 General.
During the Operating Period, and subject to the terms of this Agreement, Affiniti Golf
Partners shall have full authority and responsibility to conduct, supervise, and manage
the day-to-day operation of the Facilities including, but not limited to, the following:
(i) Supervise management of play and general operation of the
Facilities, including the establishments of all fees consistent with the
Annual Plan and Budget.
Attachment number 1
Page 2 of 24
Item # 7
(ii) Assume the responsibility of the hiring, disciplining and
terminating of all Facilities’ personnel. Affiniti will retain key city
employees currently assigned to the Augusta Municipal Golf Course as
recommended by the Owner.
(iii) Manage the Facilities in a manner that would make the Facilities
comparable with other similar first class golf courses in the vicinity of the
clubs. This to include facility staff to wear appropriate golf attire.
(iv) Recommend and establish the schedule of all prices and fees for
products and services sold at the Facilities with approval of Owner.
(v) Work with the public relations and marketing staff of the Facilities
to bring about the best possible publicity for the Facilities.
(vi) Promptly notify Owner upon the receipt of written notice from any
government entity of a violation of any applicable law, ordinance,
regulation, statute or government requirement, permit, certificate or rule
with respect to the Facilities.
In the absence of written direction or written policies of Owner, Affiniti Golf
Partners shall exercise reasonable judgment in its management activities.
Subject to the direction of Owner, Affiniti Golf Partners shall specifically
have responsibility, and commensurate authority, to provide the services
described in this Section 5.1 and to operate the Facilities in the manner
provided in this Agreement.
5.2 Annual Plan and Budget.
Not later than sixty (45) days prior to commencement of each full fiscal year thereafter,
Affiniti Golf Partners shall submit to Owner, for approval, a proposed annual business
plan and operating budget (“Annual Plan and Budget”), which shall include goals,
objectives, estimated revenues, operating expenses and capital expenditures for the
ensuing fiscal year. The Annual Plan and Budget shall contain line item expenses and
revenues and shall contain monthly and annual budgets. Owner agrees that the Annual
Plan and Budget is intended to be a reasonable estimate of the operating performance of
the Facilities for the fiscal year. With respect to monthly budgets, Owner recognizes that
such budgets are intended as Affiniti Golf Partner’s estimate of the timing of revenues and
expenses but that weather and other factors impacting the operation of the Facilities may
cause anticipated revenues or expenditures indicated in the monthly budget figures to be
accelerated or delayed. Owner acknowledges that Affiniti Golf Partners has not made any
guarantee, warranty, or representation of any nature concerning the Annual Plan and
Budget, gross receipts or operating expenses.
Each Annual Plan and Budget shall be subject to the prior written approval of Owner,
which approval shall not be unreasonably withheld. It is contemplated by the parties that
the Annual Plan and Budget will be agreed upon by the parties not later than the
beginning of the fiscal year. If Owner fails to either approve the Annual Plan and Budget
Attachment number 1
Page 3 of 24
Item # 7
by the beginning of the fiscal year or to advise Affiniti Golf Partners of its objections to the
Annual Plan and Budget within such period, then Owner shall be deemed to have
approved the Annual Plan and Budget as submitted.
Once approved, Affiniti Golf Partners may propose amendments or revisions to the
Annual Plan and Budget to take into consideration variables or events that did not exist,
or could not reasonably be anticipated by Affiniti Golf Partners, at the time the Annual
Plan and Budget was prepared. Any such proposed amendments or revisions shall be
submitted in writing and shall be subject to Owner’s prior approval, which approval shall
not be unreasonably withheld, conditioned, or delayed.
5.3 Bank Accounts; Flow of Funds.
This Agreement contemplates that the flow of funds received and disbursed in
connection with the operation of the Facilities, shall be conducted through and controlled
by a system of accounts established by Affiniti Golf Partners (the “Accounts”). Affiniti Golf
Partners will establish the Accounts in its name at a bank(s) or other financial
institution(s) as determined by Owner and Affiniti Golf Partners. Owner and Affiniti Golf
Partners’ designees (as approved by Owner, which approval will not be unreasonably
withheld) shall be the only parties authorized to draw upon such Accounts. In the event
this Agreement is terminated, Affiniti Golf Partners shall execute such instruments as are
necessary to remove as signatories on the Accounts all employees of Affiniti Golf Partners
who have been so designated.
Notwithstanding anything to the contrary, Owner shall, if sufficient funds are not
available from operations, deposit into the Accounts sufficient funds to pay all Operating
Expenses and the Management Fee.
5.4 Staff.
(A) Affiniti Golf Partners shall be responsible for hiring such qualified personnel as
Affiniti Golf Partners shall deem reasonably necessary for the successful operation and
maintenance of the Facilities and the successful marketing and management of the golf
program and other business activities at the Facilities, including, but not limited to, the
general Owner of the Facilities, a golf director and/or head golf professional and any
assistant golf professionals, a food and beverage Owner and other management
personnel. All persons so employed by Affiniti Golf Partners shall be employees of
Affiniti Golf Partners and not Owner. Affiniti Golf Partners shall hire, promote,
discharge, transfer and supervise the work of all employees of the Facilities, all at
Affiniti Golf Partners’ reasonable discretion. Owner shall have the right to provide
comments to Affiniti Golf Partners about any employee in a Ownerial or supervisory
position prior to Affiniti Golf Partners hiring said personnel. Affiniti Golf Partners shall
hire and employ such personnel at such wages or salaries and on such terms and
conditions as are standard for such personnel at the time in the geographical
Attachment number 1
Page 4 of 24
Item # 7
employment market where the Facilities are located. Affiniti Golf Partners shall pay all
of the salaries, wages, payroll taxes and benefits due and owing to and/or on account of
such persons out of the Accounts. Affiniti Golf Partners shall deduct from such
employees’ salaries all required taxes, charges and assessments and shall make and file
such reports as may be required by the federal, state and local government agencies.
(B) Affiniti Golf Partners shall be responsible for compliance with all laws, regulation
and tax requirements relative to payroll and employment of all employees of the Facilities.
(C) All employees shall be employed by Affiniti Golf Partners. In addition to the Base
Fee and Incentive Fee, Owner shall be responsible to reimburse Affiniti Golf Partners for
all charges for the employment of such employees (including, without limitation,
employee salaries, bonuses, benefits, payroll taxes, workers compensation premiums,
unemployment premiums, health insurance, dental insurance, fringe benefits, etc.), it
being acknowledged by Owner and Affiniti Golf Partners that said charges shall be passed
through directly to Owner. For purposes of this sub-paragraph (C) the parties agree that
the costs passed through shall be all of the direct costs of employment (e.g., employee
salaries, bonuses, benefits, payroll taxes, workers compensation premiums,
unemployment premiums, health insurance, dental insurance, fringe benefits, payroll
services, etc).
5.5 Accounting.
Affiniti Golf Partners shall provide, with the exception of income tax returns, complete
accounting services for the Facilities, including accounts payable, supervision of payroll
processing, bank and general ledger reconciliations, cash management, sales and liquor
tax returns, and financial statement preparation. This work does not include the work of a
club accountant on site to prepare much of this work, membership statements, etc.
5.6 Fees and Charges.
Subject to the approval of Owner, Affiniti Golf Partners shall establish, maintain, revise
and administer the overall charge structure of the Facilities, including, without limitation,
membership initiation fees and dues, resident and nonresident greens fees, golf cart
rental fees, driving range fees, golf club rentals and any other services provided at the
Facilities.
5.7 Permits and Licenses.
Affiniti Golf Partners shall apply for, obtain and maintain or, when necessary, assist
Owner in applying for and obtaining all registrations, licenses, permits, approvals and
renewals thereof as Affiniti Golf Partners deems necessary for the lawful operation of the
Facilities, and such licenses, permits and renewals shall be obtained and maintained in
the name of Owner. Affiniti Golf Partners shall renew all registrations, licenses, and
Attachment number 1
Page 5 of 24
Item # 7
permits obtained hereunder and maintain same in full force and effect. All such
registrations, licenses, permits and renewals shall be the sole and exclusive property of
Owner. Without limiting the foregoing, Affiniti Golf Partners shall make commercially
reasonable efforts to secure for the Facilities, at the expense of the Owner, liquor licenses
that will permit the Facilities to offer patrons alcoholic beverages in conjunction with their
use and enjoyment of the Facilities. Said license shall permit Affiniti Golf Partners, as
exclusive Owner of the Facilities, on behalf of the Owner, to serve alcoholic beverages in
the normal course of business, and to carry out reasonable management and marketing
activities associated with the serving of alcoholic beverages. Affiniti Golf Partners shall
comply with all local, county, state and federal laws and regulations governing the serving
of alcoholic beverages, and shall properly direct all Facilities personnel in this regard
through policies, posting of notices and supervision. The liquor license shall be and shall
remain the property of Owner.
5.8 Vendor Services.
Affiniti Golf Partners shall, as authorized agent for Owner, enter into contracts in the
name of and at the expense of Owner for the furnishing to the Facilities all services
required for operation of the Facilities, including, without limitation, electricity, gas,
water, steam, telephone, catering services, consulting services, cleaning services, vermin
extermination services, Facilities maintenance, air conditioning maintenance, and cable
television services. Affiniti Golf Partners shall purchase all materials and supplies in the
name of, for the account of, and at the expense of Owner. Provided that any such vendor
contracts do not exceed one (1) year in length or are terminable by Affiniti Golf Partners
without penalty after one (1) year, Affiniti Golf Partners may select all vendors and sign
the vendor’s contracts as authorized agent on behalf of Owner. Any other vendor contracts
will be submitted to Owner for approval which approval will not be unreasonably
withheld, conditioned or delayed.
5.9 Repairs and Maintenance.
Affiniti Golf Partners shall arrange for the making or installing, at Owner’s expense and in
the name of Owner, of all repairs, decorations, or maintenance of furnishings, fixtures or
equipment to the Facilities, as Affiniti Golf Partners deems reasonable or necessary.
5.10 Capital Expenditures.
Owner recognizes the necessity, from time to time, of improvement and replacement of
facilities, and equipment at the Facilities and other ordinary capital improvements or
replacement items (collectively the “Capital Items”). Affiniti Golf Partners agrees that the
Annual Plan and Budget shall specifically include line items for capital repair and capital
replacement to maintain the Facilities at the level and standard required under this
Agreement. Such line items for capital repairs and capital improvements shall be subject
to Owner’s approval as part of the Owner’s approval of the Annual Plan and Budget.
Affiniti Golf Partners agrees to expend, on behalf of the Owner, only such amounts as set
Attachment number 1
Page 6 of 24
Item # 7
forth in the Annual Plan and Budget for Capital Items as shall be required in the normal
and ordinary course of operations of the Facilities, in order to operate the Facilities as set
forth in this Agreement. Affiniti Golf Partners shall make recommendations to Owner
regarding the expenditure of funds budgeted for Capital Items, and the design and
installation of any Capital Items shall be subject to Owner’s prior approval and inspection.
If approved by Owner, Affiniti Golf Partners shall supervise installation of Capital Items,
in accordance with such approval.
5.11 Compliance with Laws.
Affiniti Golf Partners shall arrange at Owner’s expense for compliance in all material
respects to the extent reasonably practicable with any statutes, ordinances, laws, rules,
regulations, orders, and determinations affecting the Facilities. Affiniti Golf Partners will
notify Owner of any notice that it receives of any non-compliance with statutes,
ordinances, laws, rules, regulations, orders, and determinations, and, with the prior
written consent of Owner make arrangements for curing the non-compliance, including
without limitation, any alterations or repairs ordered or required to cure such non-
compliance. The Annual Plan and Budget shall be amended to reflect the cost of curing
such non-compliance. Such revision to the Annual Plan and Budget may include Capital
Items to the extent required by applicable law, and expenditures to comply with
applicable law shall not be subject to Owner’s prior approval if the Capital Item must be
installed on an emergency basis so as to avoid violating applicable laws, rules and
regulations. Further, Affiniti Golf Partners shall promptly discharge any lien,
encumbrance or charge on or with respect to the Facilities and the operation thereof,
other than mortgages and/or other encumbrances agreed to by Owner.
5.12 Legal Actions.
Affiniti Golf Partners shall recommend to Owner any appropriate legal actions or
proceeding to collect obligations owing to the Facilities, or to cancel or terminate any
contract with the Facilities for breach thereof or default thereunder. Owner shall consider
such recommendations and act upon them in accordance with Owner’s policies and
procedures. Owner will provide prompt notice to Affiniti Golf Partners regarding the
chosen course of action.
5.13 Emergency Repairs.
In the event an emergency occurs at the Facilities as a result of fire or any other form of
casualty, which emergency presents an imminent risk to persons or property, Affiniti Golf
Partners shall have the right to take such steps and make such repairs as may be
necessary to protect damage to persons or property and to mitigate any potential future
damage to the Facilities. Notwithstanding the foregoing, Affiniti Golf Partners agrees that
to the extent the costs of such repair and replacement is less than $10,000.00 in such
circumstance, Affiniti Golf Partners shall have the right to undertake such emergency
repairs without Owner’s prior approval; provided, however, Affiniti Golf Partners agrees
that it shall endeavor to notify Owner as soon as possible of the occurrence of such event,
but in any event shall, within forty-eight (48) hours after the occurrence of any such
Attachment number 1
Page 7 of 24
Item # 7
emergency, notify Owner of the occurrence and nature of such emergency, the repairs
made or proposed to be made and the estimated cost thereof. The costs of such emergency
repairs shall be deducted from general operating funds of the Facilities subject to
replenishment of such funds from any applicable insurance proceeds. To the extent the
costs of repairs exceeds $10,000.00, Affiniti Golf Partners shall not undertake such repair
without the Owner’s prior written consent; provided, however, Affiniti Golf Partners may
expend up to $10,000.00 to stabilize the situation or mitigate potential further damage to
the Facilities.
6. Statements and Reports
Affiniti Golf Partners shall render statements to Owner as follows:
6.1 Monthly Statements.
On or before the twentieth (20th) day of each calendar month, Affiniti Golf Partners shall
render to Owner, a detailed statement of profit and loss together with a cash flow
summary of the Facilities for the preceding calendar month and year to date for the
portion of the operating year ended on the last day of such preceding calendar month.
6.2 Special Reports.
Affiniti Golf Partners shall prepare additional special reports from time to time at the
request of Owner to the extent such reports shall cover subject matters which are within
the normal scope of Affiniti Golf Partners’ contractual services under this Agreement.
6.3 Annual Statements.
On or before the thirty-first (31st) day after the end of each operating year, Affiniti Golf
Partners shall provide to Owner, a detailed statement of income and expenses of the
Facilities for the preceding operating year.
7. Compensation and Expenses
7.1 Management Fee.
As compensation for the services to be rendered by Affiniti Golf Partners
during the term of this Agreement, Owner will pay a Management Fee (which
amounts shall be paid by Affiniti Golf Partners from the Accounts) said fee to
consist of a base fee (the “Base Fee”) and an incentive fee (the “Incentive Fee”) as
more fully described in Exhibit A attached hereto. The Base Fee shall be due and
payable on the first day of each calendar month. The Incentive Fee shall be
calculated and any fees earned shall be distributed once per fiscal year after the
twelfth (12th) month on a fiscal year basis. The payment would be made no later
than thirty (30) days after the close of the twelfth (12th) month each fiscal year.
Attachment number 1
Page 8 of 24
Item # 7
7.2 Expenses.
Within ten (10) days after submission of appropriate invoices, the Facilities shall
reimburse Affiniti Golf Partners for all reasonable direct expenses incurred by
Affiniti Golf Partners’ in the course of providing the services contemplated in this
Agreement. Such expenses shall include, without limitation, travel, mileage, meals
and lodging expenses incurred by Affiniti Golf Partners personnel in connection
with such services. Affiniti Golf Partners personnel will fly “coach” and utilize,
whenever possible, relationships between the Facilities and area hotels to keep
such reimbursable costs as low as reasonably possible. Except as otherwise
provided for in this Agreement in Section 7.3, all indirect costs associated with the
providing of these services, such as off-site overhead, wages of Affiniti Golf
Partners personnel located off-site, off-site secretarial services and otherwise, shall
be the sole responsibility of Affiniti Golf Partners.
7.4 Affiniti Golf Partners Authorization to Draw.
Any required payments by Owner under Sections 7.1 and 7.2 shall be drawn by
Affiniti Golf Partners from the Accounts.
7.5 Renovation or Material Changes
In the event a Facility is closed for repair or renovation, or, if the annual business
plan is materially changed by the Owner, then Owner and Affiniti Golf Partners
agree that the total compensation to Affiniti Golf Partners will not be less than that
paid for the previous fiscal year.
8. Insurance
8.1 Required Coverage.
8.1.1 Owner agrees to procure and maintain, at all times during the
Operating Period, a minimum of the following insurance:
(i) Insurance on the Facilities and contents, including without
limitation the furnishings and equipment and operating inventories, against loss or
damage by fire, lightning and/or any other perils insurable under the form of “all risk”
coverage then available (including specifically irrigation and/or sprinkler system
leakage damage, vandalism and malicious mischief, if available), in an amount equal to
the full replacement value of the improvements and contents and with no co-insurance
provisions.
(ii) Business interruption insurance covering actual losses
sustained due to fire, lightning and other perils insurable under the form of “all risk”
coverage than available (including specifically irrigation and/or sprinkler system
Attachment number 1
Page 9 of 24
Item # 7
leakage damage, vandalism and malicious mischief, if available) in an amount equal to
the annual business interruption values and with no co-insurance provisions. Affiniti
Golf Partners shall be named as a loss payee to the extent of Affiniti Golf Partner’s
interests under this Agreement.
(iii) Comprehensive public liability insurance, including without
limitation bodily injury, personal injury, property damage, products liability,
innkeeper’s liability, contractual liability covering the provisions of this Agreement, and
liquor liability, in an amount not less than five million dollars ($5,000,000.00) single
limit per occurrence. Affiniti Golf Partners shall be a named insured on this policy.
(iv) Automobile liability insurance in an amount not less than
one million dollars ($1,000,000.00) single limit per occurrence. Affiniti Golf Partners
shall be a named insured on this policy.
8.1.2 Affiniti Golf Partners agrees to procure and maintain, as an
Operating Expense, at all times during the Operating Period, worker’s compensation
insurance covering all Facilities’ employees, employer’s liability insurance and
employment practices liability insurance in an amount not less than five hundred
thousand dollars ($500,000.00) or as required by law covering all Facilities’ employees,
and both such policies shall not contain a provision for participation by the insured in
any loss limits.
8.1.3 If Affiniti Golf Partners does not receive a certificate of insurance
from Owner’s insurance carrier or broker reflecting the effective maintenance of the
required policies of insurance as specified in Section 8.1 above within fifteen (15) days
following the Effective Date or at any time within fifteen (15) days prior to expiration of
any such policy, Affiniti Golf Partners may proceed to procure insurance coverage as
required in Section 8.1 with the cost of such insurance to be an expense of the Facilities
payable by Owner and drawn from the Accounts by Affiniti Golf Partners.
8.1.4 Owner acknowledges and understands that Affiniti Golf Partners
has made no representations or warranties that insurance specified in this Agreement is
adequate to protect Owner.
8.1.5 To the extent insurance coverages are required by any agreement
that binds the Owner or the Facilities that exceed the coverages shown in Section 8.1,
Affiniti Golf Partners shall maintain at Owner’s expense insurance of such additional
type and amount as Owner shall be required to carry.
Attachment number 1
Page 10 of 24
Item # 7
8.2 Policies.
All insurance coverage provided for under Section 8.1 above shall be secured through
policies issued by insurance companies of good reputation and of sound and adequate
financial responsibility having a general policy holder’s rating of not less than “A” and a
financial rating of not less than Class “X” in the most current edition of Best’s Insurance
Reports. The party procuring such insurance shall deliver to the other party certificates of
insurance with respect to all of the policies of insurance so procured, and in the case of
insurance about to expire, shall deliver certificates of insurance with respect to renewal
policies not less than fifteen (15) days prior to the respective dates of expiration.
8.3 Endorsements.
All policies of insurance provided for under Section 8.1 above shall, to the extent
obtainable, have attached an endorsement that such policy shall not be cancelled or
materially changed without at least thirty (30) days prior written notice to Owner and
Affiniti Golf Partners. The comprehensive public liability insurance required under
Section 8.1 and the automobile liability insurance required under Section 8.1 shall contain
an endorsement to the effect that such insurance shall be primary to any similar insurance
that may be carried by Affiniti Golf Partners.
8.4 Blanket Policies.
Any insurance policies provided by Owner under Section 8.1 may be affected under
policies of blanket insurance that cover other properties in addition to the Facilities, and
in such case an allocable portion of the premiums for such blanket policies of insurance
shall be charged to the Facilities.
8.5 Waiver of Claims; Waiver of Subrogation.
Neither Affiniti Golf Partners nor Owner shall assert against the other, and Owner and
Affiniti Golf Partners hereby waive with respect to each other, any claims and rights of
recovery for any losses, damages, liability or expenses (including attorneys’ fees) incurred
or sustained by either of them on account of injury to persons or damage to property
arising out of the Ownership, operation and maintenance of the Facilities. The foregoing
waiver applies to each party and to each party’s directors, officers, employees,
shareholders and agents to the extent the loss or damage is covered by the injured party’s
insurance or the insurance the injured party is required to carry under this Section 8.
Owner and Affiniti Golf Partners shall use commercially reasonable efforts to obtain from
the insurance companies providing insurance under this Agreement a written subrogation
waiver indicating that such insurance company waives all right of recovery by way of
subrogation which such insurance company may acquire against Owner or Affiniti Golf
Partners (as the case may be) and their insurance companies.
Attachment number 1
Page 11 of 24
Item # 7
8.6 Handling of Claims.
Owner understands and agrees that with respect to all policies of insurance required
under Section 8.1 (whether such policies are maintained by Owner or by Affiniti Golf
Partners), the portion of any losses, damages, and expenses paid with respect to such
claims which is subject to a deductible amount or a self-insurance or a self-assumption
amount shall be the sole responsibility of Owner and such amount shall be paid from the
Accounts.
8.7 Notice Of Claims.
Owner and Affiniti Golf Partners shall give prompt notice to the other of any third party
claims made against either or both of them, and shall cooperate fully with each other and
with any insurance carrier to the end that all such claims will be properly investigated,
defended and adjusted. Affiniti Golf Partners shall not hire any attorneys to defend any
such claim against Owner without Owner consent.
9. Events of Default
9.1 Owner.
With respect to Owner it shall be an event of default (“Event of Default”) hereunder if:
(1) Upon five (5) days written notice, Owner shall fail to make or cause to be
made any payment to Affiniti Golf Partners or to the Accounts required to
be made hereunder or to make any payment pursuant to any other
agreement between the parties;
(2) Owner shall fail to keep, observe or perform any agreement, term or
provision of this Agreement to be kept, observed or performed by it, and
such default shall continue for a period of thirty (30) days after notice
thereof to Owner by Affiniti Golf Partners; provided, however, Owner shall
not be in default if such matter cannot be reasonably cured within such
thirty (30) days and Owner commences cure within such thirty (30) days
and diligently prosecutes such cure to completion.
(3) (i) Owner applies for or consents to the appointment of a receiver, trustee
or liquidator of Owner or of all or a substantial part of its assets; (ii) Owner
files a voluntary petition in bankruptcy or commences a proceeding
seeking reorganization, liquidation, or an arrangement with creditors; (iii)
Owner files an answer admitting the material allegations of a bankruptcy
petition, reorganization proceeding, or insolvency proceeding filed against
Owner; (iv) Owner admits in writing its inability to pay its debts as they
come due; (v) Owner makes a general assignment for the benefit of
creditors; or (vi) an order, judgment or decree is entered by a court of
competent jurisdiction, on the application of a creditor, adjudicating
Attachment number 1
Page 12 of 24
Item # 7
Owner a bankrupt or insolvent or approving a petition seeking
reorganization of Owner or appointing a receiver, trustee or liquidator of
Owner or of all or a substantial part of its assets, and such order, judgment
or decree continues unstayed and in effect for any period of sixty (60)
consecutive days.
(4) One or more golf holes, the clubhouse, maintenance building, or any
material service of the Facilities shall be rendered incapable of normal
operation because of weather, fire or casualty, and shall not be repaired,
restored, rebuilt, or replaced within (twelve (12) months) after casualty,
subject to delay for force majeure.
(5) Through no fault of Affiniti Golf Partners, the licenses required for the
operation of the Facilities are at any time suspended, terminated, or
revoked, and such suspension, termination, or revocation shall continue
unstayed and in effect for a period of one-hundred eighty (180) days
consecutively, subject to delay for force majeure.
(6) A default after any applicable grace period or notice and cure period exists
and continues under any applicable debt document with respect to the
Facilities.
9.2 Affiniti Golf Partners.
With respect to Affiniti Golf Partners, it shall be an Event of Default
hereunder if Affiniti Golf Partners shall fail to keep, observe, or perform any
material agreement, term or provision hereof required to be kept, observed,
or performed by it, and such failure shall continue for a period of thirty (30)
days after notice thereof shall have been given to Affiniti Golf Partners by
Owner; provided, however, Affiniti Golf Partners shall not be in default if
such matter cannot be reasonably cured within such thirty (30) days and
Affiniti Golf Partners commences cure within such thirty (30) days and
diligently prosecutes such cure to completion.
10. Remedies Upon Default
10.1 Remedies of Affiniti Golf Partners.
If any Event of Default by Owner shall occur, which is not cured within the
applicable cure period, if any, Affiniti Golf Partners may (in addition to any
other remedy available to it in law or equity including, without limitation,
damages arising from the breach) terminate this Agreement. In the event
Affiniti Golf Partners elects to terminate this Agreement, in addition to the
remedies above, Affiniti Golf Partners may recover as full liquidated
damages for future Base Fees and Incentive Fees that could have been
Attachment number 1
Page 13 of 24
Item # 7
earned under this Agreement, an amount equal the most recent three
months base and incentive fees earned.
Affiniti Golf Partners and Owner have made these provisions for liquidated
damages as it would be difficult to calculate on the date hereof, the amount
of actual damages for such breach and agree that these sums represent
reasonable compensation to Affiniti Golf Partners for such breach by
Owner.
10.2 Remedies of Owner.
If any Event of Default by Affiniti Golf Partners shall occur and be
continuing, Owner may, as its sole and exclusive remedy on account of such
Event of Default, forthwith terminate this Agreement. In such event,
Affiniti Golf Partners shall be entitled to receive payment of all undisputed
and unpaid amounts due to Affiniti Golf Partners pursuant to the terms
hereof with interest at ten percent (10%) per annum until paid, unless
prohibited or otherwise limited under applicable law, in which event such
charges shall not exceed the amount collectible under such law, and neither
party shall have any further obligations whatsoever under this Agreement,
except pursuant to the indemnity provisions of Section 11.
10.3 Rights Cumulative; No Waiver.
The failure of either party hereto to insist any time upon the strict
observance or performance of any of the provisions of this Agreement or to
exercise any right or remedy as provided in this Agreement, shall not impair
any such right or remedy or be construed as waiver or relinquishment
thereof with respect to subsequent defaults. Every right and remedy given
by this Agreement to the parties hereof may be exercised from time to time
and as often as may be deemed expedient by the parties hereto, as the case
may be.
11. Termination
11.2 Termination by Owner
Notwithstanding the provisions of 9.1 of this Agreement, Owner may terminate
this Agreement without cause or justification at any time. Owner shall give
Affiniti Golf Partners sixty (60) days written notice. Upon effective date of
termination of this Agreement, all amounts due and owing between parties shall
become immediately due and payable. All amounts due to or from a party shall
be paid through the effective date of termination in the same manner such
amounts would have been paid if this Agreement had not been terminated. The
Attachment number 1
Page 14 of 24
Item # 7
amount of any incentive fee due Affiniti Golf Partners shall be computed as of the
effective date of termination.
11.2 Termination by Affiniti Golf Partners
So long as Owner is not in default of any provision of the Agreement, Affiniti Golf
Partners shall not, without written consent of Owner, be entitled to terminate this
Agreement. During any Renewal Term, Affiniti Golf Partners shall be entitled to
terminate this Agreement upon three months written notice to Owner. In the event
that, in accordance with the terms hereof, Affiniti Golf Partners terminates this
Agreement, Affiniti Golf Partners shall be entitled to receive its compensation
through and including the actual date of termination as provided in the notice to
Owner.
12. Indemnification
12.1 To the extent not covered by Owner’s insurance, Owner agrees to
indemnify, protect, defend, and hold harmless Affiniti Golf Partners and its Owners,
officers, directors, and employees from and against any and all claims, demands,
actions, lawsuits, proceedings, damages, liabilities, judgments, penalties, fines,
attorneys’ fees, costs and expenses through all levels of appeal:
(i) which result from any event, condition, or activity occurring or existing
prior to the Effective Date; or
(ii) which relate to any labor or employment condition or situation occurring or
existing prior to the Effective Date; or
(iii) which relate to or arise from the presence in, on, under or about the
Facilities, or the escape, seepage, leakage, spillage, discharge, emission or
release, of any hazardous materials, toxic substances or petroleum products
(as defined or regulated under any and all applicable federal, state and local
environmental, health or safety laws, ordinances and regulations) from or
through the Facilities, including without limitation any and all costs of any
required or necessary repair, cleanup, remediation or decontamination of
the Facilities, and the preparation and implementation of any closure,
remedial or other required plans; or
(iv) which results from any act or omission by Affiniti Golf Partners in
connection with the management and operation of the Facilities (1) that is
expressly authorized by this Agreement, or (2) that is within the scope of
Affiniti Golf Partner’s duties under this Agreement, or (3) that is within
Affiniti Golf Partner’s delegated authority under this Agreement, or (4) that
Attachment number 1
Page 15 of 24
Item # 7
was either at the direction of Owner, unless such act or omission constitutes
gross negligence or willful misconduct on the part of any employee of
Affiniti Golf Partners (and is neither at the direction of Owner nor with the
approval of Owner), in which event Affiniti Golf Partners shall not be
indemnified under this Section 11.1; and
(v) which results from any act or omission constituting gross negligence or
willful misconduct on the part of Owner or its employees.
13. Trade Names and Intellectual Property
The Facilities shall be known by such trade name and/or trademark or logo as may from
time to time be determined by Owner. All names, logos and designs used at the Facilities
shall be the exclusive property of Owner. However, during the term of this Agreement
Affiniti Golf Partners shall have a non-exclusive license to use such names, logos and
designs in connection with the operation of the Facilities.
Affiniti Golf Partners may identify the Facilities as golf courses managed and operated by
Affiniti Golf Partners and may use the name “Affiniti Golf Partners, Inc.” or the Affiniti
Golf Partners, Inc. logo alone or in conjunction with other words or names or designs
owned by Affiniti Golf Partners or any of its affiliates. It is recognized that the name
“Affiniti Golf Partners, Inc.” together with any other names, logos or designs owned by
Affiniti Golf Partners or any of its affiliates and used in the management and operation of
the Facilities (including without limitation any such names, logos or designs used in
connection with the restaurant, banquet rooms and meeting rooms in and about the
Facilities), together with appurtenant goodwill, are the exclusive property of Affiniti Golf
Partners or its affiliates (collectively, the “Affiniti Golf Partners-Owned Names”).
Accordingly, Owner agrees that no right or remedy of Owner for any default on the part of
Affiniti Golf Partners under this Agreement shall, nor shall any provision of this
Agreement, confer upon Owner or its successors or assigns the right to use Affiniti Golf
Partners-Owned Names in the operation of the Facilities or otherwise.
All intellectual property of the Club including but not limited to websites, proprietary
software, and/or systems are the property of the Owner. Upon termination of this
Agreement, such property will remain with the Owner.
14. Notices
Any and all notices, consents, or directives by either party intended for the other shall be
in writing and shall be deemed to have been duly given as of the date and time the same
are personally delivered, or within three (3) days after depositing with the United States
Postal Service, postage prepaid by registered or certified mail, return receipt requested, or
within one (1) day after depositing with Federal Express or other nationally recognized
Attachment number 1
Page 16 of 24
Item # 7
overnight delivery service from which a receipt may be obtained, and addressed as
follows, unless either party shall have designated a different address by serving written
notice of change or address as provided herein.
If to Owner: Mr. Tom Beck
City of Augusta, Georgia
Director, Recreation, Parks & Facilities Department
2027 Lumpkin Rd.
Augusta, GA 30906
If to Owner: Mr. Whitney Crouse
Affiniti Golf Partners
3430 Highway Nine
Alpharetta, GA 30004
15. Sale or Transfer of Control
In the event of the sale or other transfer of control over the Facilities, Owner will assign
this Agreement to the purchaser or transferee, and upon such assignment and the written
assumptions by the purchaser of all the obligations of Owner to Affiniti Golf Partners
hereunder, Owner shall be fully released and relieved of all obligations hereunder.
16. Force Majeure
If at any time it becomes necessary in either party’s reasonable opinion to cease
operation of all or part of the Facilities to protect the Facilities or the health, safety and
welfare of tenants, invitees, guests or employees of the Facilities for reasons of force
majeure such as, but not limited to, acts of war, insurrection, civil strife and commotion,
labor unrest, contagious illness, catastrophic events, or acts of God, then, in such event,
Affiniti Golf Partners or Owner may close and cease operation of all or part of the
Facilities, reopening and commencing operation when such may be done without
jeopardy to the Facilities, its tenants, invitees, guests and employees. The time for
performance of an obligation to which such force majeure applies shall be extended for a
period of time equivalent to the delay from such cause, provided that at no time shall the
safety or welfare of Facilities’ tenants, invitees, guests or employees be at risk nor shall
Owner’s interest in the Facilities be threatened or otherwise be put in jeopardy.
17. Casualty and Condemnation
17.1 In the event fire, windstorm or other casualty shall damage or destroy the
Facilities or any portion thereof, Owner may restore the Facilities, or at Owner’s sole
option, terminate this Agreement immediately upon written notice to Affiniti Golf
Attachment number 1
Page 17 of 24
Item # 7
Partners without any claim of liability against Owner by Affiniti Golf Partners. If Owner
elects not to restore the Facilities, Owner shall pay to Affiniti Golf Partners a
termination fee equal to the prior year’s Base Fee plus Incentive Fee, which fee shall be a
termination fee.
17.2 If the whole of the Facilities shall be taken or condemned in any eminent
domain, condemnation, compulsory acquisition or similar proceeding by any competent
authority for any public or quasi-public use or purpose, or if such portion which is
materially all thereof shall be taken or condemned and as a result the Facilities can no
longer be operated as contemplated herein in an economically viable manner, this
Agreement shall terminate as of the date of such taking. Upon such termination, neither
party shall have any further obligation to the other party hereunder, except with respect
to liabilities accruing, or based upon events occurring, prior to the effective date of such
termination. If this Agreement is not terminated as set forth above, Owner may, in
Owner’s sole discretion, repair any damage to the Facilities, or part thereof, or alter or
modify the Facilities, or part thereof, or elect to terminate this Agreement immediately
upon written notice to Affiniti Golf Partners.
18. Definitions
1. “Net Operating Income” shall mean that amount, if any, by which Gross Revenues
exceed Gross Operating Expenses for the particular period in question.
“Gross Revenues” shall mean all receipts derived and actually received from the
operation of the Facilities from cash or credit transactions during the term of the
Agreement, computed on an accrual basis, including, but not limited to, initiation fees or
deposits, member dues, guest fees, the amount of all sales (wholesale or retail) of goods,
wares, or merchandise on, at, or from the Facilities or for services of any nature
performed on, at, or from the Facilities, determined in accordance with generally accepted
accounting principles applied on a consistent basis. Gross Revenues shall be reduced by
any refunds, rebates, discounts, and credits of a similar nature given, paid, or returned by
Affiniti Golf Partners in the course of obtaining such Gross Revenues.
Gross Revenues shall not include:
(A) Applicable gross receipts taxes, sales and use taxes, or similar
governmental charges collected directly from patrons, members or their
guests or as a part of the sales price of any goods or services;
(B) Gratuities added to billings as compensation to employees of the
Facilities,
(C) Proceeds of borrowings by Owner;
(D) Insurance proceeds paid as a result of an insurable loss, unless paid for
the loss or interruption of business;
(E) Any portion of any initiation fee or deposit which may be refundable;
Attachment number 1
Page 18 of 24
Item # 7
(F) Any eminent domain, condemnation or similar proceeds with respect to
the Facilities;
(G) Proceeds from the sale of Capital Items;
(H) Sales of any property, capital assets or other assets not in the ordinary
course of business; or
(I) Any funds provided by Owner.
2. “Operating Expenses” shall mean all operating expenses of the Facilities incurred
or paid on behalf of Owner during the term of the Agreement, computed on an
accrual basis, including, but not limited to, the following items:
(A) Salaries, wages, employee benefits, and payroll expenses, including
payroll taxes, and insurance of (a) all employees employed on-site in the
direct operation of the Facilities, (b) all employees employed off-site to
the extent their responsibilities are directly related to the day-to-day
operation of the Facilities;
(B) Marketing, advertising, and promotional expenses;
(C) Replacement of inventories of maintenance parts and supplies, food
stores and bar supplies;
(D) Replacement of broken, lost or damaged silverware, chinaware,
glassware, cooking utensils and other similar items of equipment.
(E) Office supplies, postage, printing, routine office expenses, and accounting
services incurred in the on-site operation of the Facilities;
(F) The management fee;
(G) The costs of entertainment at the Facilities;
(H) Reasonable travel expenses of on-site employees incurred exclusively in
connection with the business of the Facilities;
(I) Accrual of a reserve for insurance and property taxes each fiscal month in
an amount or at a rate that is sufficient to pay such insurance premiums
or property taxes when they become due and payable;
(J) Insurance premiums for Owner’s insurance and property taxes;
(K) Auditing, accounting costs, payroll fees, computer fees, and legal fees
incurred in respect of the operation of the Facilities;
(L) Costs incurred for utilities, including, but not limited to all electric, gas,
and water costs, and any other private utility charges incurred in
connection with the operation of the Facilities;
(M) All lease payments on any item of furniture, fixtures, or equipment
utilized in the operation of the Facilities, except as set forth below;
(N) All out-of-pocket expenses incurred by Affiniti Golf Partners in providing
the services under the terms of this Agreement; and
(O) All other customary and reasonable expenses incurred in the operation of
the Facilities.
Attachment number 1
Page 19 of 24
Item # 7
Any of the above provisions resulting in a double inclusion as an Operating Expense shall
be allowed as an inclusion only once. Operating Expenses shall not include, although
Owner shall be responsible for paying and Owner shall fund the Accounts sufficient to
make such payments, (i) depreciation or amortization, (ii) principal or interest payments
on indebtedness, (iii) ground lease rent, (iv) deductible, co-insurance, self-insurance or
similar amounts payable with respect to any occurrence or insurance claim, and (v)
federal and state income taxes incurred by Owner. Operating Expenses shall also not
include any items excluded from Gross Revenues, which nevertheless have to be paid by
Owner or the Facilities.
19. Miscellaneous
19.1 Entire Agreement.
This Agreement sets forth the entire agreement of the parties hereto and cannot be
changed or modified except by another agreement in writing signed by the party sought to
be charged therewith or by its duly authorized agent.
19.2 Non-Assignability.
Except as otherwise provided, this Agreement cannot be assigned, encumbered or
subcontracted by either party without the prior written consent of the other party, which
consent shall not be unreasonably withheld.
19.3 Executed Counterparts.
This Agreement may be executed in one or more counterparts, each of which shall for all
purposes be deemed an original.
19.4 Captions.
The captions of various of the provisions of this Agreement are included for convenience
only, and are in no way to be construed as part of this Agreement or as a limitation upon
the scope of the particular provisions to which they refer.
19.5 Successor and Assigns.
This Agreement and all the provisions hereof shall be binding upon, and shall inure to the
benefit of, the parties hereto and their respective successors and assigned.
19.6 Governing Law.
This Agreement shall be governed and construed in accordance with the laws of the State
in which the Facilities are located.
Attachment number 1
Page 20 of 24
Item # 7
19.7 Severability.
If any of the provisions of this Agreement shall be construed to be illegal or invalid, such
construction shall not affect the legality or validity of any of the other provisions hereof,
and the illegal or invalid provisions hereof shall be deemed stricken and deleted from this
Agreement to the same extent as if never incorporated herein, but all other provisions
hereof shall remain in full force and effect.
19.8 Attorneys’ Fees.
In the event it becomes necessary for either party hereto to file suit to enforce this
Agreement or any provision contained herein, the party prevailing in such suit shall be
entitled to recover, in addition to all other remedies or damages, as provided herein,
reasonable attorneys’ fees, paralegal fees and costs incurred in such suit at trial, appellate,
mediation, arbitration, bankruptcy and/or administrative proceedings.
19.9 No Third Party Beneficiaries.
It is the intention of the parties to this Agreement that no third party shall have the
benefit of or any right under any of the provisions hereof.
19.10 Non-recordation.
This Agreement may, at the option of Affiniti Golf Partners, be recorded in any office or
place of public record.
19.11 Inspection of Facilities.
Owner, and its lenders and agents, shall have the right from time to time to inspect the
Facilities.
19.12 Confidentiality.
The terms and provisions of this Agreement shall be confidential between Owner
and Affiniti Golf Partners and shall be released to third parties only in connection with
carrying out their respective duties and obligations described herein, in connection with
any order of court, to comply with governmental rules and regulations, and as required
by any proposed purchaser or mortgagee of all or any portion of Owner’s or Affiniti Golf
Partner’s interests in the Facilities and this Agreement, and then only to the extent as
may be reasonable necessary. The foregoing shall not be construed to limit Affiniti Golf
Partner’s ability to announce both privately and publicly that it manages the Facilities.
19.13 Time of the Essence.
Time is of the essence of this Agreement.
19.14 Estoppel Certificate; Release of Agreement.
Attachment number 1
Page 21 of 24
Item # 7
Affiniti Golf Partners and Owner agree to furnish to the other party from time to
time, within ten (10) days after request by such party, an Estoppel certificate setting
forth any defaults under this Agreement known to the party furnishing the Estoppel
certificate, stating that this Agreement is unmodified and in full force and effect or, if
not, stating the details of any modification and whether this Agreement as modified is in
full force and effect and the date to which payments have been made. Such Estoppel
certificate shall be provided at no cost to the requesting party. Upon termination of this
Agreement, Affiniti Golf Partners shall, upon request by Owner, execute such
documents and instruments in recordable form as may be necessary to evidence
termination of this Agreement and all rights of Affiniti Golf Partners hereunder.
19.15 No Party Deemed Draftsman.
The Owner and Affiniti Golf Partners have negotiated all provisions of this
Agreement at arms length and with full representation by their respective legal counsel.
This Agreement shall not be construed for or against either party by reason of the
authorship or alleged authorship of any provision hereof or by reason of the status of the
respective parties. Owner and Affiniti Golf Partners agree that no party shall be deemed
to be the draftsman of this Agreement and further that in the event that this Agreement
is ever construed by a court of law, such court shall not deem either party to be the
draftsman of this Agreement.
19.16 Survival of Covenants.
Any covenant, term or provision of this Agreement, which, in order to be
effective, must survive the termination of this Agreement, shall survive any such
termination.
19.17 Incorporation by Reference.
The recitals first set forth above in this Agreement and all exhibits, appendices
and attachments hereto are hereby incorporated herein by reference and made a part of
this Agreement.
19.18 Calculation of Time Periods.
Wherever under the terms and provisions of this Agreement the time for
performance falls upon a Saturday, Sunday, or legal holiday, such time for performance
shall be extended to the next following business day.
In witness whereof, Owner and Affiniti Golf Partners have executed, or caused to be
executed, this Agreement by and through their duly authorized officers all as of the day
and year first above written.
Attachment number 1
Page 22 of 24
Item # 7
For The Owner
By:________________________________________
Its:________________________________________
Attest:_____________________________________
For Affiniti Golf Partners
By:________________________________________
Its:________________________________________
Attest:_____________________________________
Attachment number 1
Page 23 of 24
Item # 7
Exhibit “A”
Management Fees
The management fee for the first 12 months of operation shall be $5,000 per month and
shall include turnkey club operations and accounting services. Each year, on the
anniversary of this Agreement, the monthly fee shall increase by 3%.
Affiniti Golf Partners will have the ability to earn an incentive fee to the aforementioned
base fee, with said incentive fee paid according to and commensurate with the financial
performance of the club. The incentive fee is typically set at an additional 25% of the total
base fee or ($15,000). The total management fee incentive is paid if the budgeted EBITDA
for the club is attained. The management fees shall be paid through a combination of a
monthly base fee and an incentive fee, the latter to be paid once per year within 30 days of
the end of the twelfth month of the fiscal year.
An example of how the EBITDA Incentive Fee would be paid is as follows:
If the budgeted EBITDA goal is achieved, Affiniti receives the full/budgeted incentive
fee. For every dollar achieved greater than the EBITDA goal, we calculate the % above
the EBITDA goal and Affiniti receives the same amount of % higher than the Incentive
Fee. For every dollar achieved less than EBITDA goal we calculate the % below the
EBITDA goal and Affiniti receives the same amount of % lower than the Incentive Fee.
Attachment number 1
Page 24 of 24
Item # 7
Options for Operation of
Augusta Municipal Golf Course
“The Patch”
Item # 7
Option 1
Continue Current Operations
Option 2
Lease all Operations to Private Entity
Option 3
Implement “Patch Committee”
Recommendation to Hire Management
Firm and Partner with First Tee of Augusta
Item # 7
Option 1 :
Continue Current Operations
•Operated in house by City forces
•Staffing would continue as current
•Place operation in General Fund (i.e. Augusta
Aquatics Center & Newman Tennis Center)
•City responsible for all expenses & revenues
•Financial Impact
–2010 Actual Net (before cost allocation &
depreciation) - ($142,295)
–2011 Actual Net (before cost allocation &
depreciation) - $72,807
Item # 7
Key Points of Option 1:
•Customer service continues as known
product
•City has control over rates and fees and all
other operations
•City would in all probability continue to
operate in a financial deficit
•New ideas & services would be limited
Option 1 - Continue Current Operations
Item # 7
•RFP-10-142A was issued by Augusta Procurement
Department and opened February 11, 2011
•One (1) compliant bidder: Patch of Augusta, LLC.
–Principal Owners:
Brian Hendry – Aberdeen, Scotland
Michael Kistler – Savannah, Georgia
–Met minimum service requirements of bid
–New Company
–Interview panel rated overall proposal at 80.8 out of
100
Option 2:
Lease Golf Course to Private Entity
Item # 7
Option 2:
Lease Golf Course to Private Entity
Continued
•Highlights of Proposal
–Want to keep rates affordable for 51 weeks
of the year
–Major emphasis on Master’s week for
revenue through packages and rate
increases
–Ten (10) year lease
Item # 7
•Financial Impact
–All expenses and revenues are inherited
by Patch of Augusta, LLC
–General Fund subsidy will end of $ 150,000
to $200,000 per year
–Will pay City of Augusta $ 1,000 per month
or $ 12,000 per year
–Will pay City of Augusta $ 80,000 for
existing equipment
Option 2:
Lease Golf Course to Private Entity
Continued
Item # 7
Key Points of Option 2:
•Eliminates all financial risk for City of
Augusta
•New ideas for improved services could be
beneficial
•City loses control over rates and fees
•Current Golf Course Staff would not be
guaranteed employment
Option 2 - Lease Golf Course to Private Entity
Item # 7
•“Patch Committee” was comprised of representatives of
Paine College, Augusta State University, Richmond
County Board of Education, First Tee of Augusta, and
members of the Patch.
•Report presented to Augusta Commission February 15,
2011 consisted of the following primary
recommendations:
–That a professional golf management company be hired to
operate the golf course. It is our belief that hiring an
experience management company has the highest
probability of improving the operation and financial position
of the course and thus ensuring the long-term viability of
The Patch.
Option 3:
Implement “Patch Committee”
Recommendation to Hire Management Firm
and Partner with First Tee of Augusta
Item # 7
–That a commission be established to oversee the
management company in order to protect the interests of
the Commission, taxpayers, and constituents that currently
utilize The Patch. This is similar to the model currently
employed by the Forest Hills Golf Course, which has
enjoyed recent success in increasing both the profitability
and the improving the golfer’s experience.
–That rates and dues be increased
–That advertising and promotion be increased to a
reasonable level
–That food and beverage operations be expanded
–That the course officially be renamed “The Patch”
Option 3:
Implement “Patch Committee”
Recommendation to Hire Management Firm
and Partner with First Tee of Augusta
Continued
Item # 7
Projected Cash Flow with Management Company
2011 2012 2013 2014 2015
Rounds 22,050 23,000 24,000 25,000 26,000
Club Revenues
Golf 419,184 445,989 474,688 504,356 535,020
Food & Beverage 77,616 82,579 87,893 93,386 99,064
Total Club Revenues: 496,080 534,197 575,006 617,194 660,799
Cost of Goods Sold
Golf Merchandise 11,576 11,808 12,044 12,285 12,531
Food & Beverage 27,115 28,849 30,705 32,624 34,608
Total Cost of Goods Sold: 38,691 40,657 42,749 44,909 47,139
Gross Margin – Operations 457,389 493,540 532,257 572,285 613,660
Club Expenses
Golf 148,096 151,058 154,079 157,161 160,304
Food & Beverage 31,857 32,494 33,144 33,806 34,483
Maintenance 153,113 156,175 159,299 162,485 165,735
G & A 138,148 140,911 143,729 146,604 149,536
Total Club Expenses: 471,214 480,638 490,250 500,055 510,058
Net Operating Cash Flow: (13,825) 12,902 42,006 72,229 103,602
Management Fees: (75,000) (75,000) (75,000) (75,000) ( 75,000)
Net: (88,824) (62,098) (32,993) ( 2,770)28,604
Item # 7
Partnership with First Tee of Augusta
-First Tee would reduce size of lease from forty (40) acres to
approximately twenty (20) acres
-Six (6) golf holes would be reduced to two (2) holes and new
practice tee would be constructed
-Augusta Municipal Golf Course would provide maintenance
and upkeep of First Tee through a service contract
-Augusta Municipal Golf Course would provide guaranteed tee
times to First Tee participants at a reduced rate
-Projected new net revenues from First Tee of Augusta: $ 30K to
$50K
-Approximately twenty (20) acres could be purchase by Augusta
State University for future expansion.
- Proceeds from sale could be allocated back to both Augusta
Municipal Golf Course and First Tee of Augusta for course
improvements
Item # 7
Summary of Projected First Year Financials
(not Including Cost Allocation/Depreciation)
Operating loss: ($ 13,824)
New Revenue-First Tee: $ 30,000
Net: $ 16,176
Item # 7
Key Points of Option 3:
•City retains control over rates and fees
•Management contract term is flexible
•First Tee of Augusta program continues
•Augusta State University potentially can acquire needed
property from expansion
•New ideas from management firm could be beneficial
•City retains employment approval for all Golf Course staff
employed by management firm
•Deficit reduction still an unknown
•Cost of management firm contract: approx. $ 75,000 per
year
Option 3: Implement "Patch Committee" Recommendation to Hire
Management Firm and Partner with First Tee of Augusta
Item # 7
Other Options
Item # 7
Attachment number 3
Page 1 of 4
Item # 7
Attachment number 3
Page 2 of 4
Item # 7
Attachment number 3
Page 3 of 4
Item # 7
Attachment number 3
Page 4 of 4
Item # 7
Attachment number 4
Page 1 of 16
Item # 7
Attachment number 4
Page 2 of 16
Item # 7
Attachment number 4
Page 3 of 16
Item # 7
Attachment number 4
Page 4 of 16
Item # 7
Attachment number 4
Page 5 of 16
Item # 7
Attachment number 4
Page 6 of 16
Item # 7
Attachment number 4
Page 7 of 16
Item # 7
Attachment number 4
Page 8 of 16
Item # 7
Attachment number 4
Page 9 of 16
Item # 7
Attachment number 4
Page 10 of 16
Item # 7
Attachment number 4
Page 11 of 16
Item # 7
Attachment number 4
Page 12 of 16
Item # 7
Attachment number 4
Page 13 of 16
Item # 7
Attachment number 4
Page 14 of 16
Item # 7
Attachment number 4
Page 15 of 16
Item # 7
Attachment number 4
Page 16 of 16
Item # 7
CommissionMeetingAgenda
8/2/20115:00PM
AnOrdinancetoAmendtheAugusta,GA.CodeSection s8-1-5through8-1-9RelatingtotheCreationandDutiesof
thePlanningandDevelopmentDepartment
Department:Administrator
Caption:Motionto approveanOrdinancetoamendtheAugusta,GA.CodeTitle
EightChapterOneArticleOneSections8-1-5throug h8-1-9relatingto
theCreationandDutiesofthePlanningandDevelop mentDepartment;to
repealallCodeSectionsandOrdinancesandpartof CodeSectionsand
Ordinancesinconflictherewith;toprovideaneffe ctivedateandforother
purposes.(ApprovedbytheCommissionJuly19,2011-second
reading)
Background:OnMarch30,2011,theAugustaGeorgiaCommissiona pprovedthe
Administrator’sreorganizationplanasdescribedin theAugusta,Georgia
ProposedGovernmentReorganizationDraftProjectPl an.ThisProject
PlanrequiresthecreationofanAugusta,GeorgiaP lanningand
DevelopmentDepartment.
Analysis:ToupdateandamendtheCodeasrelatedtoThisOrd inanceestablishes
theAugusta,GeorgiaPlanningandDevelopmentDepar tmenttobe
consistentwiththeProposedGovernmentReorganizat ionDraftProject
Plan.
FinancialImpact:N/A.
Alternatives:DeclinetoamendCodeatthistime.
Recommendation:Approve.
FundsareAvailablein
theFollowing
Accounts:
N/A.
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 8
ORDINANCE NO. ___________
An Ordinance to Amend the Augusta, GA. Code Title Eight Chapter One
Article One Sections 8-1-5 through 8-1-9 Relating to the Creation and Duties
of the Planning and Development Department; To Repeal All Code Sections
and Ordinances and Part of Code Sections and Ordinances in Conflict
Herewith; To Provide an Effective Date and for Other Purposes.
WHEREAS, on March 30, 2011, the Augusta Georgia Commission approved the
$GPLQLVWUDWRU¶VUHRUJDQL]DWLRQSODQDVGHVFULEHGLQWKe Augusta, Georgia Proposed
Government Reorganization Draft Project Plan; and
WHEREAS, such Proposed Government Reorganization Draft Project Plan
requires the creation of an Augusta, Georgia Planning and Development
Department; and
WHEREAS, Augusta, Georgia desires to update and amend the Code as related to
the creation of the Augusta, Georgia Planning and Development Department to be
consistent with the Proposed Government Reorganization Draft Project Plan;
THE AUGUSTA, GEORGIA COMMISSION, ordains as follows:
SECTION 1. AUGUSTA, GA. CODE Sections 8-1-5 through 8-1-9 as set forth in the
Augusta, Ga. Code, re-adopted July 10, 2007, are hereby amended by striking
these sections in their entirety DVVHWIRUWKLQ³([KLELW$´KHUHWRand inserting in
lieu thereof new Code Sections 8-1-5 through 8-1-9, restated as set forth in
³([KLELW%´KHUHWR
SECTION 2. This ordinance shall become effective the first day of November,
2011.
SECTION 3. All ordinances or parts of ordinances in conflict herewith are hereby
repealed.
Adopted this _____ day of , 2011.
___________________________
David S. Copenhaver
As its Mayor
Attest:
Attachment number 1
Page 1 of 7
Item # 8
______________________________
Lena J. Bonner, Clerk of Commission
Seal:
Attachment number 1
Page 2 of 7
Item # 8
CERTIFICATION
The undersigned Clerk of Commission, Lena J. Bonner, hereby certifies that
the foregoing Ordinance was duly adopted by the Augusta, Georgia Commission
on_________________, 2011 and that such Ordinance has not been modified or
rescinded as of the date hereof and the undersigned further certifies that attached
hereto is a true copy of the Ordinance which was approved and adopted in the
foregoing meeting(s).
______________________________
Lena J. Bonner, Clerk of Commission
Published in the Augusta Chronicle.
Date: ______________________
First Reading ______________________
Second Reading ______________________
Attachment number 1
Page 3 of 7
Item # 8
Exhibit A
Secs. 8-1-5. ± 8-1-9. Reserved.
Attachment number 1
Page 4 of 7
Item # 8
Exhibit B
Sec. 8-1-5. Creation of Planning and Development Department; Duties - Generally.
(a) The Augusta, Georgia Planning and Development Department is hereby established, and
the Commission shall employ the necessary staff to administer and enforce the provisions
of this and related Chapters.
(b) The person in charge of the Augusta, Georgia Planning and Development Department
shall be known as the Director of Planning and Development. The Director shall enforce
the provisions of this and related Chapters, and he/she or his/her duly authorized
representative shall perform any duty imposed upon him/her by this and related Chapters.
(c) The Planning and Development Department shall have as its duties and responsibilities
the following:
(1) Prepare and recommend to the Planning Commission a Master Plan or parts thereof
for the development of Augusta, Georgia.
(2) Prepare and recommend to the Planning Commission a Comprehensive Zoning
Ordinance and map or maps thereto;
(3) Prepare and recommend to the Planning Commission zoning map(s) and Special
Exceptions;
(4) Prepare, publish, and distribute maps, plans, reports, and recommendations relating to
the planning and development of Augusta, Georgia;
(5) Recommend to the Augusta, Georgia Commission programs for public improvements
and financing thereof;
(6) In the performance of these functions, enter upon land, make examinations and
surveys, and place and maintain necessary signs, monuments, or markings thereon;
(7) Any other function or duty delegated to the Planning and Development Department or
its Director under the provisions of this Code; and
(8) Any other function or duty which may from time to time be delegated to the Planning
and Development Department or its Director.
Sec. 8-1-6. Performance of duties ± Master Plan.
(a) It shall be the duty of the Planning and Development Department to prepare and
recommend for adoption and amendment a Master Plan of Augusta, Georgia to the
Planning Commission.
(b) Such Master Plan may show, among other things, the following:
Attachment number 1
Page 5 of 7
Item # 8
(1) Existing and proposed streets, highways, expressways, bridges, tunnels and viaducts
and approaches thereto; routes of railroads and transit lines; terminals, ports and
airports.
(2) Parks, playgrounds, forests and other public open spaces.
(3) Sites for public buildings, structures and facilities.
(4) Land areas for residential, business, industrial, recreational, agricultural, forestry, and
special purposes and uses.
(5) Limited development areas for purposes of conservation, water supply, sanitation,
drainage, historic preservation, protection against flooding and similar environmental
considerations.
(6) Areas for housing development, slum clearance, and urban renewal and
redevelopment.
(7) Location of public utilities whether publicly or privately owned, including but not
limited to sewerage and water supply.
(8) Zoning districts and other planning features.
(9) Time and priority schedules and cost estimates for the accomplishment of the
proposals.
(c) The Master Plan shall be based upon and include appropriate studies of the location and
extent of present and anticipated other pertinent data.
(d) Such Plan may be adopted, added to and changed from time to time by the Augusta,
Georgia Commission. It shall be a public record, but its purpose and effect shall be
solely to aid the Planning and Development Department and the Planning Commission in
the performance of their duties.
Sec. 8-1-7. Performance of duties ± Zoning ordinance and maps.
(a) It shall be the duty of the Planning and Development Department to prepare and
recommend for adoption and amendment to the Planning Commission a zoning ordinance
and map or maps. The purpose of such ordinance and map or maps shall be to regulate:
(1) The location, height, bulk, number of stories, and size of buildings and other
structures.
(2) The percentage of lot which may be occupied, the sizes of yards, courts, and other
open areas.
(3) The density and distribution of population and dwelling units.
Attachment number 1
Page 6 of 7
Item # 8
(4) Land areas for residential, business, industrial, recreational, agriculture, forestry,
conservation, historic preservation, water supply, sanitation, protection against floods,
governmental activity and other special purposes.
(b) The map or maps shall divide Augusta, Georgia into districts of such number, shape and
size as the Planning Commission may determine; and within such districts the Planning
Commission may regulate the erection, construction, reconstruction, alteration, and use of
building and structures and uses of land. All such regulations shall be uniform for each
class or kind of building throughout each district, but the regulations in one district, but
the regulations in one district may differ from those in other districts.
(c) At such time the Augusta, Georgia Commission deems it necessary to enact an entirely
new zoning ordinance and map or maps, the governing bodies shall hold a public hearing
thereon, after at least fifteen (15) days notice of the time and place of which shall be
published in a newspaper of general circulation in Augusta, Georgia. All procedural
standards set forth in the Official Code of Georgia shall be complied with.
(1) No change or departure from the text or maps, as certified by the Planning
Commission, shall be made unless such change or departure is first submitted to the
Planning Commission for review and recommendation.
(2) The Planning Commission shall have thirty (30) days within which to submit its
report. If the Planning Commission fails to submit a report within a thirty-day period,
it shall be deemed to have approved the change or departure.
(d) The zoning ordinance, including the map or maps, may be amended from time to time;
but no amendment shall become effective unless it shall have been proposed by or shall
have first been submitted to the Planning Commission for review and recommendation.
(1) The Planning Commission shall conduct, on behalf of the Augusta, Georgia
Commission, all public hearings on proposed amendments to the zoning ordinance
and maps.
(2) Policies and procedures as specified by the Official Code of Georgia shall be
followed by the Planning Commission in considering such public hearings.
Secs. 8-1-8. ± 8-1-9. Reserved.
Attachment number 1
Page 7 of 7
Item # 8
CommissionMeetingAgenda
8/2/20115:00PM
AuditandAssessment/EfficiencyStudy
Department:ClerkofCommission
Caption:Motionto approve taskingtheAdministratorandrelatedstaffto
developinthirtydaysforCommissionreviewanRF Pand/or
RFQforasolicitationfromprofessionalhumanres ourcesfirms
foranindependentauditandassessment/efficiency studyof
AugustaRichmondCountyGovernment.(Approvedby
AdministrativeServicesCommitteeJuly25,2011)
Background:
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 9
CommissionMeetingAgenda
8/2/20115:00PM
MotiontoAmendAugusta,GACodeSection1-2-36
Department:Law
Caption:Motionto approveanOrdinancetoamendtheAugusta,GACode
TitleOneChapterTwoArticleThreeSection1-2-36 relatingto
theDutiesoftheAdministratorofAugusta,Georgia ;torepealall
CodeSectionsandOrdinancesinconflictherewith;toprovidean
effectivedateandforotherpurposes.(Norecommendationfrom
AdministrativeServicesCommitteeJuly25,2011)
Background:
Analysis:
FinancialImpact:
Alternatives:Deny
Recommendation:Approve
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Finance.
Law.
Administrator.
ClerkofCommission
Cover Memo
Item # 10
ORDINANCE NO. ___________
AN ORDINANCE TO AMEND THE AUGUSTA, GA CODE TITLE ONE
CHAPTER TWO ARTICLE THREE SECTION 1-2-36 RELATING TO
DUTIES OF THE ADMINISTRATOR OF AUGUSTA, GEORGIA; TO
REPEAL ALL CODE SECTIONS AND ORDINANCES AND PARTS OF
CODE SECTIONS AND ORDINANCES IN CONFLICT HEREWITH; TO
PROVIDE AN EFFECTIVE DATE AND FOR OTHER PURPOSES.
WHEREAS, on June 21, 2011, the Augusta Georgia Commission approved
UHPRYLQJWKHZRUG³H[FOXVLYH´IURPWKH$GPLQLVWUDWRU¶VGXWLHV; and
WHEREAS, Augusta, Georgia desires to update and amend the Code as related to
the duties of the Administrator to be consistent with the aforementioned approval.
THE AUGUSTA, GEORGIA COMMISSION, ordains as follows:
SECTION 1. AUGUSTA, GA. CODE Section 1-2-36 as set forth in the Augusta, Ga.
Code, re-adopted July 10, 2007, is hereby amended by striking this section in its
entirety DVVHWIRUWKLQ³([KLELW$´KHUHWRand inserting in lieu thereof new Code
Section 1-2-36, restated as set forth in ³([KLELW%´KHUHWR
SECTION 2. This ordinance shall become effective upon its adoption in
accordance with applicable laws.
SECTION 3. All ordinances or parts of ordinances in conflict herewith are hereby
repealed.
Adopted this _____ day of , 2011.
___________________________
David S. Copenhaver
As its Mayor
Attest:
______________________________
Lena J. Bonner, Clerk of Commission
Seal:
Attachment number 1
Page 1 of 8
Item # 10
CERTIFICATION
The undersigned Clerk of Commission, Lena J. Bonner, hereby certifies that
the foregoing Ordinance was duly adopted by the Augusta, Georgia Commission
on_________________, 2011 and that such Ordinance has not been modified or
rescinded as of the date hereof and the undersigned further certifies that attached
hereto is a true copy of the Ordinance which was approved and adopted in the
foregoing meeting(s).
______________________________
Lena J. Bonner, Clerk of Commission
Published in the Augusta Chronicle.
Date: ______________________
First Reading ______________________
Second Reading ______________________
Attachment number 1
Page 2 of 8
Item # 10
Exhibit A
Sec. 1-2-36. Duties.
The Administrator for Augusta, Georgia shall be the administrative officer of
Augusta, Georgia and head of the administrative branch of Augusta, Georgia
government. The Administrator shall be responsible to the Mayor and
Commission for the proper administration of all affairs of Augusta, Georgia, and
his duties shall be as follow:
(a) To have the exclusive right to recommend for appointment or removal all
Augusta, Georgia department heads, subject to the approval of the
Commission, with the exception of the General Counsel, the Clerk of
Commission, the Equal Employment Opportunity Director, and the
Disadvantaged Business Enterprise Liaison, all of whom shall be appointed
and discharged directly by the Mayor and Commission;
(b) Subject to the rules and regulations of the Commission, where applicable,
the Administrator for Augusta, Georgia shall be the appointed authority for
all other Augusta, Georgia employees whose appointment is now or
hereinafter vested in the Commission, and shall have the right to employ and
discharge the same;
(c) To execute all lawful orders, directions, instructions, and all ordinances,
resolutions and regulations adopted by the Commission consistent with this
Code and entered upon the minutes of the Commission; in the execution of
these matters, except as otherwise provided in the Augusta, Georgia Charter,
the Administrator shall keep the Mayor fully informed and shall coordinate
with the Mayor to ensure that all laws, ordinances, and resolutions of
Augusta, Georgia are faithfully executed;
(d) To have supervision over all departments or divisions of Augusta, Georgia
now or hereinafter subject to the jurisdiction of the Commission, with the
exception of the General Counsel, the Clerk of Commission, the Equal
Employment Opportunity Director, and the Disadvantaged Business
Enterprise Liaison, all of whom shall report directly to the Mayor and
Commission;
(e) To attend all meetings of the Commission, with the right to take part in the
discussion;
(f) To prepare and to recommend salary scales for all employees;
Attachment number 1
Page 3 of 8
Item # 10
(g) To prescribe the duties and supervise the work of Augusta, Georgia
employees, with the exception of the Augusta, Georgia Law Department, the
Clerk of Commission, the Equal Employment Opportunity Director, and the
Disadvantaged Business Enterprise Liaison, all of whom shall report directly
to the Mayor and Commission;
(h) To require reports from heads of departments, and other employees trusted
with administrative duties or exercising discretion, with the exception of the
General Counsel, the Clerk of Commission, the Equal Employment
Opportunity Director, and the Disadvantaged Business Enterprise Liaison,
all of whom shall report directly to the Mayor and Commission;
(i) To prepare and submit to the Mayor and Commission a proposed annual
budget; when the budget has been prepared and adopted as provided by law
by the Commission, it shall be the duty of the Administrator for Augusta,
Georgia to execute the budget; no department or office of Augusta, Georgia
government shall exceed the budget without the approval of the
Commission;
(j) To keep the Mayor and Commission fully advised on the financial
conditions and future needs of Augusta, Georgia and shall make such
recommendations on Augusta, Georgia affairs as the Administrator deems
necessary for the effective and efficient operation of Augusta, Georgia;
(k) To act as liaison between the Mayor and/or Commission and all Augusta,
Georgia department heads or employees of Augusta, Georgia, with the
exception of the General Counsel, the Clerk of Commission, the Equal
Employment Opportunity Director, and the Disadvantaged Business
Enterprise Liaison, all of whom shall report directly to the Mayor and
Commission;
(l) To confer with and assist all other elected or appointed officials of
Richmond County, and all departments, such as Augusta-Richmond County
health department, the Augusta-Richmond County Department of Family
and Children Services, whose missions are not under the direct control and
supervision of the Commission, but who are dependent upon the
appropriations of the Commission for their continued operation;
(m) To submit to the Mayor and Commission at the end of each fiscal year a
complete report on the finances and administrative activities of Augusta,
Georgia for the preceding year;
Attachment number 1
Page 4 of 8
Item # 10
(n) To see that all legislation, programs, regulations or plans promulgated and
required by the state or federal government are duly carried out and
complied with in accordance with such legislation, programs, regulations or
plans;
(o) To approve all position classifications, reclassifications, reorganizations, and
pay adjustments up to fifteen (15%) percent of base pay and provide the
Administrative Services Committee with a monthly report of such
adjustment(s) following any calendar month during which such
adjustment(s) were made; and
(p) To perform such other duties as may be required for him by the Mayor and
Commission.
Attachment number 1
Page 5 of 8
Item # 10
Exhibit B
Sec. 1-2-36. Duties of Administrator.
The Administrator for Augusta, Georgia shall be the administrative officer of
Augusta, Georgia and head of the administrative branch of Augusta, Georgia
government. The Administrator shall be responsible to the Mayor and
Commission for the proper administration of all affairs of Augusta, Georgia, and
his duties shall be as follow:
(a) To have the right to recommend for appointment or removal all Augusta,
Georgia department heads, subject to the approval of the Commission, with
the exception of the General Counsel, the Clerk of Commission, the Equal
Employment Opportunity Director, and the Disadvantaged Business
Enterprise Liaison, all of whom shall be appointed and discharged directly
by the Mayor and Commission;
(b) Subject to the rules and regulations of the Commission, where applicable,
the Administrator for Augusta, Georgia shall be the appointed authority for
all other Augusta, Georgia employees whose appointment is now or
hereinafter vested in the Commission, and shall have the right to employ and
discharge the same;
(c) To execute all lawful orders, directions, instructions, and all ordinances,
resolutions and regulations adopted by the Commission consistent with this
Code and entered upon the minutes of the Commission; in the execution of
these matters, except as otherwise provided in the Augusta, Georgia Charter,
the Administrator shall keep the Mayor fully informed and shall coordinate
with the Mayor to ensure that all laws, ordinances, and resolutions of
Augusta, Georgia are faithfully executed;
(d) To have supervision over all departments or divisions of Augusta, Georgia
now or hereinafter subject to the jurisdiction of the Commission, with the
exception of the General Counsel, the Clerk of Commission, the Equal
Employment Opportunity Director, and the Disadvantaged Business
Enterprise Liaison, all of whom shall report directly to the Mayor and
Commission;
(e) To attend all meetings of the Commission, with the right to take part in the
discussion;
(f) To prepare and to recommend salary scales for all employees;
Attachment number 1
Page 6 of 8
Item # 10
(g) To prescribe the duties and supervise the work of Augusta, Georgia
employees, with the exception of the Augusta, Georgia Law Department, the
Clerk of Commission, the Equal Employment Opportunity Director, and the
Disadvantaged Business Enterprise Liaison, all of whom shall report directly
to the Mayor and Commission;
(h) To require reports from heads of departments, and other employees trusted
with administrative duties or exercising discretion, with the exception of the
General Counsel, the Clerk of Commission, the Equal Employment
Opportunity Director, and the Disadvantaged Business Enterprise Liaison,
all of whom shall report directly to the Mayor and Commission;
(i) To prepare and submit to the Mayor and Commission a proposed annual
budget; when the budget has been prepared and adopted as provided by law
by the Commission, it shall be the duty of the Administrator for Augusta,
Georgia to execute the budget; no department or office of Augusta, Georgia
government shall exceed the budget without the approval of the
Commission;
(j) To keep the Mayor and Commission fully advised on the financial
conditions and future needs of Augusta, Georgia and shall make such
recommendations on Augusta, Georgia affairs as the Administrator deems
necessary for the effective and efficient operation of Augusta, Georgia;
(k) To act as liaison between the Mayor and/or Commission and all Augusta,
Georgia department heads or employees of Augusta, Georgia, with the
exception of the General Counsel, the Clerk of Commission, the Equal
Employment Opportunity Director, and the Disadvantaged Business
Enterprise Liaison, all of whom shall report directly to the Mayor and
Commission;
(l) To confer with and assist all other elected or appointed officials of
Richmond County, and all departments, such as Augusta-Richmond County
health department, the Augusta-Richmond County Department of Family
and Children Services, whose missions are not under the direct control and
supervision of the Commission, but who are dependent upon the
appropriations of the Commission for their continued operation;
(m) To submit to the Mayor and Commission at the end of each fiscal year a
complete report on the finances and administrative activities of Augusta,
Georgia for the preceding year;
Attachment number 1
Page 7 of 8
Item # 10
(n) To see that all legislation, programs, regulations or plans promulgated and
required by the state or federal government are duly carried out and
complied with in accordance with such legislation, programs, regulations or
plans;
(o) To approve all position classifications, reclassifications, reorganizations, and
pay adjustments up to fifteen (15%) percent of base pay and provide the
Administrative Services Committee with a monthly report of such
adjustment(s) following any calendar month during which such
adjustment(s) were made; and
(p) To perform such other duties as may be required for him by the Mayor and
Commission.
Attachment number 1
Page 8 of 8
Item # 10
Sec. 1-2-36. Duties.
The Administrator for Augusta, Georgia shall be the administrative officer of
Augusta, Georgia and head of the administrative branch of Augusta, Georgia
government. The Administrator shall be responsible to the Mayor and
Commission for the proper administration of all affairs of Augusta, Georgia, and
his duties shall be as follow:
(a) To have the exclusive right to recommend for appointment or removal all
Augusta, Georgia department heads, subject to the approval of the
Commission, with the exception of the General Counsel, the Clerk of
Commission, the Equal Employment Opportunity Director, and the
Disadvantaged Business Enterprise Liaison, all of whom shall be appointed
and discharged directly by the Mayor and Commission;
(b) Subject to the rules and regulations of the Commission, where applicable,
the Administrator for Augusta, Georgia shall be the appointed authority for
all other Augusta, Georgia employees whose appointment is now or
hereinafter vested in the Commission, and shall have the right to employ and
discharge the same;
(c) To execute all lawful orders, directions, instructions, and all ordinances,
resolutions and regulations adopted by the Commission consistent with this
Code and entered upon the minutes of the Commission; in the execution of
these matters, except as otherwise provided in the Augusta, Georgia Charter,
the Administrator shall keep the Mayor fully informed and shall coordinate
with the Mayor to ensure that all laws, ordinances, and resolutions of
Augusta, Georgia are faithfully executed;
(d) To have supervision over all departments or divisions of Augusta, Georgia
now or hereinafter subject to the jurisdiction of the Commission, with the
exception of the General Counsel, the Clerk of Commission, the Equal
Employment Opportunity Director, and the Disadvantaged Business
Enterprise Liaison, all of whom shall report directly to the Mayor and
Commission;
(e) To attend all meetings of the Commission, with the right to take part in the
discussion;
(f) To prepare and to recommend salary scales for all employees;
Attachment number 2
Page 1 of 3
Item # 10
(g) To prescribe the duties and supervise the work of Augusta, Georgia
employees, with the exception of the Augusta, Georgia Law Department, the
Clerk of Commission, the Equal Employment Opportunity Director, and the
Disadvantaged Business Enterprise Liaison, all of whom shall report directly
to the Mayor and Commission;
(h) To require reports from heads of departments, and other employees trusted
with administrative duties or exercising discretion, with the exception of the
General Counsel, the Clerk of Commission, the Equal Employment
Opportunity Director, and the Disadvantaged Business Enterprise Liaison,
all of whom shall report directly to the Mayor and Commission;
(i) To prepare and submit to the Mayor and Commission a proposed annual
budget; when the budget has been prepared and adopted as provided by law
by the Commission, it shall be the duty of the Administrator for Augusta,
Georgia to execute the budget; no department or office of Augusta, Georgia
government shall exceed the budget without the approval of the
Commission;
(j) To keep the Mayor and Commission fully advised on the financial
conditions and future needs of Augusta, Georgia and shall make such
recommendations on Augusta, Georgia affairs as the Administrator deems
necessary for the effective and efficient operation of Augusta, Georgia;
(k) To act as liaison between the Mayor and/or Commission and all Augusta,
Georgia department heads or employees of Augusta, Georgia, with the
exception of the General Counsel, the Clerk of Commission, the Equal
Employment Opportunity Director, and the Disadvantaged Business
Enterprise Liaison, all of whom shall report directly to the Mayor and
Commission;
(l) To confer with and assist all other elected or appointed officials of
Richmond County, and all departments, such as Augusta-Richmond County
health department, the Augusta-Richmond County Department of Family
and Children Services, whose missions are not under the direct control and
supervision of the Commission, but who are dependent upon the
appropriations of the Commission for their continued operation;
Attachment number 2
Page 2 of 3
Item # 10
(m) To submit to the Mayor and Commission at the end of each fiscal year a
complete report on the finances and administrative activities of Augusta,
Georgia for the preceding year;
(n) To see that all legislation, programs, regulations or plans promulgated and
required by the state or federal government are duly carried out and
complied with in accordance with such legislation, programs, regulations or
plans;
(o) To approve all position classifications, reclassifications, reorganizations, and
pay adjustments up to fifteen (15%) percent of base pay and provide the
Administrative Services Committee with a monthly report of such
adjustment(s) following any calendar month during which such
adjustment(s) were made; and
(p) To perform such other duties as may be required for him by the Mayor and
Commission.
Attachment number 2
Page 3 of 3
Item # 10
CommissionMeetingAgenda
8/2/20115:00PM
MotiontoAmendAugusta,GACodeSection1-7-51Reg ardingAdministrator'sRecommending
AuthorityandforOtherPurposes
Department:Law
Caption:Motionto approveanOrdinancetoamendtheAugusta,GACode
TitleOneChapterSevenArticleFourSection1-7-51 relatingto
theadoptionofPersonnelPoliciesandProcedureso fAugusta,
Georgia;tomodifyAdministrator'sRecommendingAut hority;to
repealallCodeSectionsandOrdinancesandpartso fCode
SectionsandOrdinancesinconflictherewith;topr ovidean
effectivedateandforotherpurposes.(Norecommendationfrom
AdministrativeServicesCommitteeJuly25,2011)
Background:
Analysis:
FinancialImpact:
Alternatives:Deny
Recommendation:Approve
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Finance.
Law.
Administrator.
ClerkofCommission
Cover Memo
Item # 11
ORDINANCE NO. ___________
AN ORDINANCE TO AMEND THE AUGUSTA, GA CODE TITLE ONE
CHAPTER SEVEN ARTICLE FOUR SECTION 1-7-51 RELATING TO
THE ADOPTION OF PERSONNEL POLICIES AND PROCEDURES OF
AUGUSTA, GEORGIA; TO REPEAL ALL CODE SECTIONS AND
ORDINANCES AND PARTS OF CODE SECTIONS AND ORDINANCES
IN CONFLICT HEREWITH; TO PROVIDE AN EFFECTIVE DATE AND
FOR OTHER PURPOSES.
WHEREAS, on June 21, 2011, the Augusta Georgia Commission approved
UHPRYLQJWKHZRUG³H[FOXVLYH´IURPWKH$GPLQLVWUDWRU¶VGXWLHV DQG
WHEREAS, Augusta, Georgia desires to update and amend the Personnel Policy
and Procedures Manual as related to the duties of the Administrator to be
consistent with the aforementioned approval.
THE AUGUSTA-RICHMOND COUNTY COMMISSION, ordains as follows:
SECTION 1. Appendix B to the Augusta Georgia Code as incorporated in
AUGUSTA, GA. CODE Section 1-7-51, also known as the Augusta, Georgia
Personnel Policy and Procedures Manual, is hereby amended by striking the word
³H[FOXVLYH´IURPWKHVHFRQGVHQWHQFHRIWKHVHFRQGSDUDJUDSK XQGHU³(PSOR\HHV
&RYHUHG´RQ3DJH
SECTION 2. This ordinance shall become effective on the first day of the first
month following adoption in accordance with AUGUSTA, GA. CODE Section 1-7-51.
SECTION 3. All ordinances or parts of ordinances in conflict herewith are hereby
repealed.
Adopted this _____ day of , 2011.
___________________________
David S. Copenhaver
As its Mayor
Attest:
______________________________
Lena J. Bonner, Clerk of Commission
Attachment number 1
Page 1 of 3
Item # 11
Seal:
Attachment number 1
Page 2 of 3
Item # 11
CERTIFICATION
The undersigned Clerk of Commission, Lena J. Bonner, hereby certifies that
the foregoing Ordinance was duly adopted by the Augusta-Richmond County
Commission on_________________, 2011 and that such Ordinance has not been
modified or rescinded as of the date hereof and the undersigned further certifies
that attached hereto is a true copy of the Ordinance which was approved and
adopted in the foregoing meeting(s).
______________________________
Lena J. Bonner, Clerk of Commission
Published in the Augusta Chronicle.
Date: ______________________
First Reading:
Second Reading:
Attachment number 1
Page 3 of 3
Item # 11
Attachment number 2
Page 1 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 2 | P a g e
Formatted: Centered
Table of Contents
PERSONNEL POLICY & PROCEDURES MANUAL
INTRODUCTION ...................................................................................................................... 11
CHAPTER I. ATTENDANCE & LEAVE POLICY ............................................................... 12
Section 100.001 Normal Hours of Operation ..................................................................... 12
Section 100.002 Attendance ............................................................................................. 12
Section 100.003 Break Time ............................................................................................ 12
Section 100.004 Alternative Work Schedules .................................................................. 12
Section 100.005 Use of Accrued Compensatory Time Off ................................................ 16
Section 100.006 Holidays ................................................................................................ 16
Section 100.007 Annual Leave/Sick Leave Accrual .......................................................... 17
Section 100.008 Fire Suppresion Personnel Paid Leave Policy ......................................... 18
Section 100.009 Scheduling Annual Leave ....................................................................... 18
Section 100.010 Request for Annual Leave ...................................................................... 18
Section 100.011 Maximum Allowable Annual Leave Carryover ....................................... 19
6HFWLRQ3D\PHQWIRU8QXVHG$QQXDO/HDYH««««« ................................... 19
Section 100.013 Rate of Payment for AL Following Promotion or Demotion ................... 19
Section 100.014 Annual Leave Buy-Back Policy .............................................................. 19
Section 100.015 Scheduling of Sick Leave ....................................................................... 20
Section 100.016 Maximum Allowable Sick Leave Carryover ........................................... 20
Section 100.017 Payment of Unused Sick Leave .............................................................. 20
Section 100.018 Sick Leave Pool Policy ........................................................................... 20
Section 100.019 Sick Leave Pool Eligibility ..................................................................... 21
Section 100.020 Application for Membership in Sick Leave Pool ..................................... 21
Section 100.021 Sick Leave Pool Contributions................................................................ 21
Section 100.022 Use of Pooled Sick Leave ....................................................................... 22
Section 100.023 Sick Leave Pool Committee .................................................................... 23
Section 100.024 Termination of Sick Leave Pool Membership ......................................... 23
Section 100.025 Abuse of Sick Leave Pool Policy ............................................................ 23
Section 100.026 Military Leave ....................................................................................... 24
Section 100.027 Workers Compensation .......................................................................... 27
Section 100.028 Disabilities Not Covered By Workers Compensation ............................. 27
Section 100.029 Maternity Leave ..................................................................................... 28
Section 100.030 Family and Medical Leave ...................................................................... 28
Section 100.031 Leave of Absence Without Pay ............................................................... 34
Section 100.032 Leave of Absence Without Pay Regulations ........................................... 35
Section 100.033 Absence Without Leave .......................................................................... 36
Section 100.034 Leave of Absence With Pay .................................................................... 36
Section 100.035 Funeral Leave ......................................................................................... 36
Section 100.036 Jury Duty/Civic Duty Leave ................................................................... 36
Section 100.037 Special Meetings and Examinations ....................................................... 37
Section 100.038 Training and Education ........................................................................... 37
Section 100.039 Excused Absences .................................................................................. 37
Section 100.040 Days of Mourning .................................................................................. 37
Attachment number 2
Page 2 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 3 | P a g e
Formatted: Centered
Section 100.041 Emergency Leave ................................................................................... 37
Section 100.042 General Administrative Leave ................................................................ 37
CHAPTER II. EQUAL EMPLOYMENT OPPORTUNITY .................................................. 38
Section 200.001 Equal Employment Opportunity (EEO) ................................................... 38
Section 200.002 Discrimation and Harassment-Free Workplace ........................................ 38
Section 200.003 Disability Accomodation......................................................................... 39
Section 200.004 EEO Office Overview ............................................................................. 40
Section 200.005 EEO Office Mission ................................................................................ 41
Section 200.006 EEO Office Oversight and Jurisdiction ................................................... 42
Section 200.007 EEO Office Access to Information and Date Collection .......................... 43
Section 200.008 Guidelines for Assessing Educational Credentials in EEO Matters .......... 44
Section 200.009 Filing an EEO Complaint ........................................................................ 44
Section 200.010 Complaint Inquiries and Investigations ................................................... 44
Section 200.011 Complaint Process .................................................................................. 45
Section 200.012 Employee Relocation in Connection with Pending EEO Case ................. 46
Section 200.013 Confidentiality ........................................................................................ 47
Section 200.014 Honesty Code ......................................................................................... 47
Section 200.015 Management and Employee Cooperation ................................................ 47
Section 200.016 Complaint Closure .................................................................................. 47
Section 200.017 Prohibition Against Retaliation ............................................................... 48
Section 200.018 Final Internal Case Closure and Appeal Rights........................................ 48
Section 200.019 Policy Update, Jurisdiction and Other Matters ......................................... 49
CHAPTER III. GRIEVANCES, DISCIPLINE & APPEALS ................................................. 50
Section 300.001 Objective .................................................................................................. 50
6HFWLRQ*ULHYDQFH3ROLF\6FRSH««« ................................................................ 50
Section 300.003 Grievance Policy Undertaking ................................................................. 50
Section 300.004 Grievance Policy Definitions ................................................................... 51
Section 300.005 Exclusions From the Grievance Procedure. .............................................. 51
Section 300.006 Grievance Policy General Provisions ....................................................... 51
Section 300.007 Presenting a Grievance ............................................................................. 52
Section 300.008 Grievance Process .................................................................................... 52
Section 300.009 Grievance Witnesses ................................................................................ 53
Section 300.010 Grievance Documentation ........................................................................ 53
Section 300.011 Discipline................................................................................................. 54
Section 300.012 Discipline Guidelines and Procedure ........................................................ 57
Section 300.013 Appeal of Submitted and Approved Discipline ......................................... 60
Section 300.014 Appeals to the Personnel Board ................................................................ 61
Section 300.015 Personnel Board By-Laws ........................................................................ 61
Section 300.016 Appeals from the Personnel Board to the Administrator ........................... 65
Section 300.017 Appeals from the Administrator to Superior Court ................................... 65
Notice of Letter of Warning (Form HR-ER I) ..................................................................... 66
Notice of Disciplinary Action (Form HR-ER II).................................................................. 67
Notice of Disciplinary Action (Form HR-ER III) ................................................................ 69
Notice of Disciplinary Action (Form HR-ER IV) ................................................................ 70
Attachment number 2
Page 3 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 4 | P a g e
Formatted: Centered
Request for Administrative Review or Appeal (Form HR ± ER V) ...................................... 71
Notice of Final Decision (Form HR ± ER VI) .................................................................... 73
Recommended Guideline for Disciplinary Action ............................................................... 74
CHAPTER IV. CAREER LADDERS, LATTICES AND JOB TITLING POLICY .......... 79
Introduction ........................................................................................................................ 79
Section 400.001 Who is Eligible. ...................................................................................... 79
Section 400.002 What Positions are Eligible ..................................................................... 80
Section 400.003 Why Participate in Career Ladders .......................................................... 80
Section 400.004 How to Initiate a Career Ladder Progression ........................................... 80
Section 400.005 Pre-Approved Career Ladders ................................................................. 81
Section 400.006 Individual Career Ladders ....................................................................... 81
Section 400.007 Estimating Pay Rate Upon Completion ................................................... 82
Section 400.008 Supporting Documents to Start a Career Ladder ...................................... 82
Section 400.009 Process to Complete a Career Ladder Review Request ............................ 82
Section 400.010 Compensation for Degrees, Licenses, and Certifications ......................... 83
Individual Career Ladder Form (HR-CA&M I) .................................................................. 85
0DQDJHU¶V(OLJLELOLW\&KHFNOLVW)RUP +5-CA&M II) ....................................................... 87
CHAPTER V. COMPENSATION ........................................................................................... 88
A. GENERAL ........................................................................................................................ 88
Section 500.001 Compensation Philosophy ........................................................................ 88
B. COMPENSATION ADMINISTRATION ...................................................................... 90
Section 500.101 Authority of the Adminstrator .................................................................. 90
Section 500.102 Overview of Compensation Administration Program ............................... 90
Section 500.103 Compensation Program. .......................................................................... 90
Section 500.104 Components of the Compensation Program ............................................. 90
Section 500.105 Market Adjustments ................................................................................ 91
Section 500.106 Exceptional Circumstances Adjustments. ................................................ 91
Section 500.107 Effective Date of Salary Adjustment. ...................................................... 91
Section 500.108 Starting Rates for New Employees .......................................................... 91
Section 500.109 Employee Communication and Rights..................................................... 92
Section 500.110 Annual Salary Schedule Determination ................................................... 92
Section 500.111 Annual Base Salary Adjustment Date ...................................................... 93
Section 500.112 Part-time Continuing Employment .......................................................... 93
Section 500.113 Rehired Employees ................................................................................. 93
Section 500.114 Former Employees .................................................................................. 93
Section 500.115 Retirees of Augusta, Georgia Statement of Policy ................................... 93
Section 500.116 Service Credit and Benefits ..................................................................... 93
Section 500.117 Employee Lateral Transfers ................................................................... 94
6HFWLRQ7HPS:RUNDWD+LJKHU&ODVV3URYLVLRQDO(PSOR\HH« ........................ 94
Section 500.119 Promotional Increase Policy .................................................................... 94
Section 500.120 Reclassification Promotions .................................................................... 94
Section 500.121 Procedures for Determining Promotional Increase ................................... 94
Section 500.122 Disciplinary or Involuntary Demotions ................................................... 95
Section 500.123 Reclassification Demotions ..................................................................... 95
Attachment number 2
Page 4 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 5 | P a g e
Formatted: Centered
Section 500.124 Voluntary Demotions .............................................................................. 95
Section 500.125 Involuntary Demotions ............................................................................ 96
Section 500.126 Overtime Policy ...................................................................................... 96
Section 500.127 Overtime Policy for Full-time Non-exempt Employees. .......................... 96
Section 500.128 FLSA Section 207(K) Partial Exempt Employees ................................... 96
Section 500.129 FLSA Section 213(a)(3) Fully Exempt Seasonal/Recreational Employees97
Section 500.130 Overtime for Part-time, Non-Exempt Employees. ................................... 97
Section 500.131 Compensatory Time Policy For Non-Exempt Employees ........................ 97
Section 500.132 Maximum Compensation Time Accrual .................................................. 98
Section 500.133 Employees Transferring From One Department/Office to Another .......... 98
Section 500.134 Amendment of Salary Administration Program ....................................... 98
Section 500.135 Interim Salary Policy .............................................................................. 98
C. POSITION CLASSIFICATION PLAN ........................................................................... 99
Section 500.201 Classification Plan .................................................................................. 99
Section 500.202 Position Descriptions (Class Specifications) .......................................... 101
Section 500.203 Official Copy of Class and Position Descriptions .................................. 101
Section 500.204 Titles of Positions ................................................................................. 101
Section 500.205 Minimum Qualifications ....................................................................... 102
Section 500.206 Procedures for the Allocation of Positions ............................................. 102
Section 500.207 Procedures and Conditions for the Position Reallocation ....................... 102
Section 500.208 Procedures for the Re-grading of Positions ............................................ 103
Section 500.209 Maintenance of the Classification Plan .................................................. 104
Section 500.210 Dept. Reorganization/Reclassification Policy & Procedures .................. 104
Section 500.211 Conducting Job Audit ........................................................................... 105
Section 500.212 Administrative Review of Reclassification ............................................ 106
D. OTHER COMPENSATION-RELATED POLICIES ................................................... 106
Section 500.301 Compliance ........................................................................................... 106
Section 500.302 Interpretations ....................................................................................... 107
Section 500.303 Petitions ................................................................................................ 107
Section 500.304 Minimum Wage Policy ......................................................................... 107
Section 500.305 Red Circle Rate ..................................................................................... 107
Section 500.306 Green Circle Rate .................................................................................. 107
Section 500.307 Within-Grade Increase/ Step Increase Pay Policy .................................. 107
Section 500.308 Senior Executive Service (SES) Group Policy ....................................... 109
Section 500.309 Immediate Vesting for SES Employees ................................................. 111
Section 500.310 SES Group Member Affected by Reduction in Work Force Policy ......... 111
Section 500.311 SES Group Severance Pay Policy ........................................................... 112
Section 500.312 Notice of Resignation Required for SES Employees .............................. 112
Section 500.313 Moving and Relocation Expenses........................................................... 113
Section 500.314 Annual Leave for SES Employees ......................................................... 113
Section 500.315 SES Employee Probationary Period ...................................................... 113
Section 500.316 Compensation Inaccuracies and Corrections........................................... 113
CHAPTER VI. EMPLOYEE INCENTIVE AWARDS PROGRAM (EIAP) ....................... 116
Section 600.001 Purpose ................................................................................................. 116
Section 600.002 Employee of the Month/Year Performance Awards ............................... 116
Attachment number 2
Page 5 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 6 | P a g e
Formatted: Centered
6HFWLRQ3URFHGXUHVIRU³<HDUVRI6HUYLFH´$ZDUG ............................................. 118
Section 600.004 Retirement Recognition......................................................................... 119
Section 600.005 Administration and Budget ................................................................... 119
CHAPTER VII. DRESS CODE & PERSONAL APPEARANCE ........................................ 120
Section 700.001 Professional Dress and Appearance ...................................................... 120
Section 700.002 Clothing Restrictions ............................................................................ 120
Section 700.003 Uniforms .............................................................................................. 120
Section 700.004 General Prohibitions ............................................................................. 121
Section 700.005 Personal Grooming and Hygiene .......................................................... 121
Section 700.006 Policy Violations .................................................................................. 121
CHAPTER VIII. EMPLOYMENT, RECORDS & HRIS .................................................... 123
Section 800.001 Authority of Administrator .................................................................... 123
Section 800.002 Nature of Employment .......................................................................... 123
Section 800.003 Nepotism .............................................................................................. 123
Section 800.004 Position Management Program ............................................................. 124
Section 800.005 Vacant Positions ................................................................................... 126
Section 800.006 Competitive Job Posting Process ........................................................... 127
Section 800.007 Competitive Process Exemptions .......................................................... 127
Section 800.008 Application Process .............................................................................. 128
Section 800.009 Applicant Screening .............................................................................. 128
Section 800.010 Qualifications and Requirements ........................................................... 129
Section 800.011 Fire Fighter I Recruitment Procedures ................................................... 130
Section 800.012 Veteran Preference ................................................................................ 132
Section 800.013 Interview Process .................................................................................. 133
Section 800.014 Contigent Job Offer/Tentative Job Offer ............................................... 134
Section 800.015 Background Checks .............................................................................. 135
Section 800.016 Criminal History ................................................................................... 135
Section 800.017 Rejection ............................................................................................... 136
Section 800.018 Final job Offer ...................................................................................... 136
Section 800.019 Appointments/Transfers ........................................................................ 137
Section 800.020 Probation Periods .................................................................................. 140
Section 800.021 New Employee Orientation ................................................................... 140
Section 800.022 Immigration Law Compliance ............................................................... 141
Section 800.023 Conflicts of Interest ............................................................................... 141
Section 800.024 Outside Employment............................................................................. 142
Section 800.025 Political Activities ................................................................................. 142
Section 800.026 Employee Separation and Termination .................................................. 144
Section 800.027 Layoffs/Reductions in Force ................................................................. 145
Section 800.028 Employee Exit Interview ....................................................................... 146
Section 800.029 Personal Information and Personnel Records......................................... 147
Section 800.030 Access to Personnel Files ...................................................................... 147
Section 800.031 Employee Reference Checks ................................................................. 148
Section 800.032 Personnel Data Changes ........................................................................ 148
Section 800.033 Smoking ............................................................................................... 148
Section 800.034 Polygraph.............................................................................................. 148
Attachment number 2
Page 6 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 7 | P a g e
Formatted: Centered
Section 800.035 Workplace Violence .............................................................................. 149
Section 800.036 Cellular Phones ..................................................................................... 150
Section 800.037 Fitness-for-Duty Policy ......................................................................... 151
Section 800.038 Fitness-for Duty Procedures .................................................................. 152
Section 800.039 Workplace Relationships ....................................................................... 153
Section 800.040 Elected Officials and Their Employees.................................................. 154
CHAPTER IV. SUBSTANCE ABUSE .................................................................................. 155
A. GENERAL .................................................................................................................... 155
Section 900.001 Policy and Purpose ............................................................................... 155
Section 900.002 Policy Intent ......................................................................................... 155
Section 900.003 References ............................................................................................ 156
Section 900.004 Definitions ............................................................................................ 156
Section 900.005 Prohibitions .......................................................................................... 159
Section 900.006 Consequences for Violations ................................................................ 160
Section 900.007 Notification Requirements .................................................................... 160
Section 900.008 Testing Procedures ............................................................................... 160
Section 900.009 Actions Required for Positive Test ....................................................... 161
Section 900.010 Split Sample Testing ............................................................................. 162
Section 900.011 Review of Termination Recommendation ............................................. 162
Section 900.012 Rehiring Terminated Employees ........................................................... 162
Section 900.013 Alcohol Testing of Transit Employees and CDL Holders ...................... 163
Section 900.014 Refusal to Submit to Testing ................................................................. 163
Section 900.015 Confidentiality ...................................................................................... 164
Section 900.016 Contractors ........................................................................................... 165
Section 900.017 Changes to Policy ................................................................................. 165
Section 900.018 Contact Person ..................................................................................... 165
B. INDIVIDUALS SUBJECT TO TESTING .................................................................. 165
Section 900.100 Individuals Subject to Testing ............................................................... 165
Section 900.101 Applicants/New Employees ................................................................. 165
Section 900.102 Transfers/Promotions. .......................................................................... 166
Section 900.103 Return to Duty ..................................................................................... 166
Section 900.104 Post-Accident ....................................................................................... 166
Section 900.105 For-Cause (Reasonable Suspicion) Testing........................................... 167
Section 900.106 Random Testing Program. .................................................................... 168
C. MISCELLANEOUS ........................................................................................................ 170
Section 900.201 Training ............................................................................................... 170
Section 900.202 Rehabilitation Policy ............................................................................ 170
Section 900.203 Relationship to Previously Established Procedure ................................ 171
Section 900.204 Forms ................................................................................................... 171
Contractor Certificate (Form SA-1) ..................................................... 172
Substance Abuse Coverage Form (Form SA-2) ................................... 173
Test Consent Form (Form SA-3) ......................................................... 174
For-Cause Test Authorization Form (Form SA-4) ............................... 175
Supervisor Referral Form (Form SA-5) ............................................... 177
Collection Site Checklist (Form SA-6) ................................................ 179
Attachment number 2
Page 7 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 8 | P a g e
Formatted: Centered
Information Request Form (Form SA-7) ............................................. 180
Alcohol Fact Sheet (Form SA-8) ......................................................... 181
Acknowledgement of Receipt of Substance Abuse Policy (Form SA-9)183
CHAPTER X. SAFETY .......................................................................................................... 184
A. GENERAL .................................................................................................................... 184
Section 1000.001 General Safety Policy Statement ........................................................ 184
Section 1000.002 Purpose ............................................................................................. 184
Section 1000.003 Applicability ..................................................................................... 184
Section 1000.004 Program Goals .................................................................................. 184
Section 1000.005 General Provisions ............................................................................ 184
Section 1000.006 Administration .................................................................................. 185
Section 1000.007 Safety Policy Responsibilities ........................................................... 185
Section 1000.008 Risk Management Committee ........................................................... 185
Section 1000.009 Safety Review Committee ................................................................. 185
Section 1000.010 Finance Department Director ............................................................ 186
Section 1000.011 Department Directors ........................................................................ 186
Section 1000.012 Superviosry Personnell ...................................................................... 187
Section 1000.013 Department Safety Officers ............................................................... 187
Section 1000.014 Employees ........................................................................................ 188
Section 1000.015 Condition of Employment ................................................................. 188
B. VEHICLE SAFETY ..................................................................................................... 189
Section 1000.101 General Vehicle Safety Policy ........................................................... 189
Section 1000.102 Vehicle Safety Responsibilities ......................................................... 189
Section 1000.103 Driver Pre-Operation Inspections ...................................................... 190
Section 1000.104 General Vehicle Safety ...................................................................... 190
Section 1000.105 Seat Bealts ........................................................................................ 192
Section 1000.106 Items Prohibited From Being Carried in Augusta, GA Vehicles ......... 192
Section 1000.107 Reporting Driving Citations/Violations .............................................. 193
Section 1000.108 Motor Vehicle Record Checks ........................................................... 193
Section 1000.109 Age and Employment Status Restricitons........................................... 194
Section 1000.110 General Vehicle Accident Provisions ................................................. 194
Section 1000.111 Vehicle Accident Responsibilites ....................................................... 194
Section 1000.112 Vehicle Accident Procedures ............................................................. 195
Section 1000.113 Damaged Vehicles ............................................................................. 196
Section 1000.114 Vehicle Accident Investigation Purpose ............................................. 196
Section 1000.115 Required Vehicle Accident Investigations .......................................... 196
Section 1000.116 Vehicle Accident Investigation Responsibilities ................................. 197
Section 1000.117 Preparation of the Fleet Accident Report............................................ 197
Section 1000.118 Exceptions to Fllet Accident Report ................................................... 198
Section 1000.119 Witness Statements ............................................................................ 199
C. SAFETY TRAINING ................................................................................................... 199
Section 1000.201 General Safety Training ..................................................................... 199
Section 1000.202 Safety Training Specifics ................................................................... 200
Section 1000.203 Specialized Training .......................................................................... 200
Attachment number 2
Page 8 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 9 | P a g e
Formatted: Centered
D. PERSONAL PROTECTIVE EQUIPMENT (PPE) ..................................................... 201
Section 1000.301 PPE General ..................................................................................... 201
Section 1000.302 PPE Responsibilities ......................................................................... 201
Section 1000.303 General Safety Equipment ................................................................ 202
Section 1000.304 Minimum Essential Requirements .................................................... 203
Section 1000.305 Employee Non-Compliance/Non-Use of PPE ................................... 203
Section 1000.306 PPE Funding ..................................................................................... 203
E. SAFETY REVIEW COMMITTEE (SRC) .................................................................. 203
Section 1000.401 Declaration ........................................................................................ 203
Section 1000.402 SRC Purpose ..................................................................................... 204
Section 1000.403 SRC Membership .............................................................................. 204
Section 1000.404 Member Tenure ................................................................................. 204
Section 1000.405 Definitions ......................................................................................... 205
Section 1000.406 Authority ........................................................................................... 205
Section 1000.407 Penalties ............................................................................................ 206
Section 1000.408 Procedures ......................................................................................... 206
Section 1000.409 Appeals ............................................................................................. 207
Section 1000.410 Employee Files .................................................................................. 207
Section 1000.411 Employee Point System ..................................................................... 208
F. RISK MANAGEMENT COMMITTEE (RMC) ......................................................... 208
Section 1000.501 Declaration ........................................................................................ 208
Section 1000.502 RMC Membership ............................................................................. 208
Section 1000.503 Objectives.......................................................................................... 209
G. :25.(5¶6&203(16$7,21.................................................................................. 209
Section 1000.601 Purpose .............................................................................................. 209
Section 1000.602 General .............................................................................................. 209
Section 1000.603 Definitions ......................................................................................... 210
Section 1000.604 Responsibilities ................................................................................. 210
Section 1000.605 Emergency Procedures ...................................................................... 211
Section 1000.606 Non-Emergency Procedures ............................................................... 211
Section 1000.607 Clearance to Return to Work .............................................................. 212
Section 1000.608 Workers Comp. Temporary Duty Purpose ......................................... 212
Section 1000.609 Workers Comp. Temporary Duty General Guidelines ........................ 212
Section 1000.610 Workers Comp. Temporary Duty Assignment ................................... 213
Section 1000.611 Returning to Full Duty From Workers Comp. Temp. Duty ................ 213
Section 1000.612 Workers Comp. Temp. Duty Definitions ............................................ 214
Section 1000.613 Workers Comp. Temp. Duty Forms ................................................... 214
CHAPTER XI. OTHER RISK MANAGEMENT RELATED POLICIES .......................... 215
A. CLAIMS ADMINISTRATION ................................................................................... 215
Section 1100.001 Claims Administation Purpose ........................................................... 215
Section 1100.002 General Claims Administration Policy ............................................... 215
Section 1100.003 Claims Administration Responsibilities ............................................. 215
Section 1100.004 Claims Administration Procedures ..................................................... 216
Attachment number 2
Page 9 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 10 | P a g e
Formatted: Centered
B. HOUSEKEEPING ........................................................................................................ 216
Section 1100.101 Housekeeping Policy Overview ......................................................... 216
Section 1100.102 Housekeeping .................................................................................... 216
Section 1100.103 Housekeeping Procedures .................................................................. 216
Section 1100.104 Rules for Housekeeping ..................................................................... 217
C. SAFETY INSPECTIONS ............................................................................................ 217
Section 1100.201 Safety Inspections .............................................................................. 217
Section 1100.202 Inspections ........................................................................................ 217
D. LOSS PREVENTION .................................................................................................. 218
Section 1100.301 Loss Prevention Purpose .................................................................... 218
Section 1100.302 Loss Prevention Policy ...................................................................... 218
Section 1100.303 Loss Prevention Applicability ............................................................ 218
Section 1100.304 Loss Prevention Responsibilities ........................................................ 218
Section 1100.305 Lost, Damaged or Destroyed Property ............................................... 219
Section 1100.306 Theft or Vandalism ............................................................................ 219
Section 1100.307 Property Accountability ..................................................................... 219
Section 1100.308 Supplies ............................................................................................. 220
E. VEHICLE OVERSIGHT PROGRAM ........................................................................ 220
Section 1100.401 Vehicle Oversight Program Purpose .................................................. 220
Section 1100.402 Vehicle Oversight Program Concept .................................................. 220
Section 1100.403 Vehicle Oversight Program Applicability .......................................... 220
Section 1100.404 Vehicle Oversight Program Responsibilities ...................................... 220
Section 1100.405 Vehicle Oversight Program Funding .................................................. 221
CHAPTER XII. INFORMATION TECHNOLOGY ............................................................ 246
Section 1200.001 Computer Usage ................................................................................ 246
Section 1200.002 Two-Way Radios ............................................................................... 253
Section 1200.003 Department-Issued Cellular Telephones ............................................. 253
Section 1200.004 Violation of Policies .......................................................................... 254
APPENDIX
Definitions ...................................................................................................................... 255
Election of Coverage by an Elected Official ..................................................................... 270
Acknowledgement of Receipt .......................................................................................... 271
Attachment number 2
Page 10 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 11 | P a g e
Formatted: Centered
INTRODUCTION
Purpose
The purpose of this Personnel Policy and Procedures 0DQXDO ³0DQXDO´ , together with the position
classification and pay plan, is to provide the fundamental features for an effective system of personnel
administration for Augusta, Georgia. These personnel policies and procedures are not and do not form an
express or implied contract between Augusta, Georgia and its employees.
The policies and procedures of Augusta, Georgia contained herein are subject to revocation or
modification by the Augusta, Georgia Commission at any time and shall be superseded by any changes
mandated by state or federal legislation. Any official action taken by the Commission will supersede the
contents of this Manual. The intent of this Manual is to provide a source of information for Department
Directors, supervisors, and employees.
The Administrator is responsible for administering the policies and procedures of Augusta, Georgia.
Employees Covered
This Manual applies to all employees of Augusta, Georgia, and by adoption of Augusta, Georgia's elected
officers, and all boards, commissions, and authorities, unless specifically excluded by these policies and
procedures or by other state law or Augusta, Georgia ordinance.
Department Directors are at-will employees. The Administrator shall have the exclusive right to
recommend appointment and discharge of Department Directors to the Commission and the Commission
shall, at its sole discretion, approve or deny such recommendation. The Administrator, Clerk of
Commission, DBE Federal Program Director, the Equal Opportunity Director, and General Counsel shall
be appointed and discharged directly by the Augusta, Georgia Commission.
Nothing in these personnel policies and procedures should be construed as allowing SES employees or
employees of elected officials to attain a property interest in their positions.
Employees of the 911 system are excluded from the section concerning the appeals process, and instead,
may appeal directly to the 911 Committee whose decision shall be final.
However, exclusion from all or part of this Manual does not exempt anyone from equal employment
opportunity practices that may be required by state and federal laws.
Severability
If any of the provisions of these policies and procedures or if any of the regulations or orders, or the
application of such provisions to any person or circumstances shall be held inoperative, void or invalid,
the remaining portion of these policies and procedures and the application of such provisions to persons
or circumstances other than those as to which it is held inoperative, void, or invalid, shall not be affected
thereby.
These provisions supersede all existing policies and practices of Augusta, Georgia.
Attachment number 2
Page 11 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 12 | P a g e
Formatted: Centered
CHAPTER I.
ATTENDANCE AND LEAVE
Section 100.001 Normal Hours of Operation
The normal hours of operation for Augusta, Georgia are 8:30 a.m. to 5:00 p.m. Monday through Friday,
with one (1) unpaid hour for lunch. Each Department Director may establish alternative work schedules
as necessary for their department. The normal workday is seven and one-half (7.5) hours. Each
Department Director shall schedule their full-time personnel for a minimum thirty-seven and one-half
(37.5) hours per work week. This policy does not apply to any employees on shift schedules.
Section 100.002 Attendance
Each employee is responsible for the proper recording of his or her attendance. Under no circumstances LVDQHPSOR\HHWRDOWHUDQRWKHUHPSOR\HH¶VDWWHQGDQFHUHFRUGLQFOXGLQJEXWQRWOLPLWHGWRFKDQJing or ILOOLQJRXWDQRWKHUHPSOR\HH¶VWLPHFDUGDQGRUSXQFKLQJDQRWKHUHPSOR\HHLQRURXWXQOHVVVSHFLILFDOO\
authorized by the Department Director in advance. Each Department Director shall be responsible for the
attendance of all persons in his or her department. Each department shall maintain complete attendance
records on each employee. Violation of this policy may result in disciplinary action, up to and including
termination.
Section 100.003 Break Time
Non-exempt employees (other than Fire Suppression personnel) may be allowed two (2) fifteen-minute
breaks per workday at times established by their Department Director. Generally, one break will be taken
in the morning and one in the afternoon. Unused break time may not be counted toward overtime and/or
compensatory time and may not be accrued or carried over.
Section 100.004 Alternative Work Schedules
PURPOSE AND SCOPE
This policy establishes policies and procedures for the Augusta Alternative Work Schedules program.
This policy does not apply to any employees on shift schedules.
BACKGROUND
The normal hours of operation for each department are 8:30 a.m. to 5:00 p.m. with one (1) hour for lunch,
Monday thru Friday for non-shift workers. Alternative hours can be established by the Department
Director with the approval of the Administrator. Each Department Director shall schedule their full-time
personnel for a minimum thirty-seven and one-half hours per workweek.
Department Directors are encouraged to provide maximum flexibility for their employees. However,
because of specific job requirements, the same degree of personal choice may not be possible for all
employees. Department Directors have the authority and responsibility to require work hour adjustments
to meet special work situations and the responsibility to account for the overall performance of the
organization.
Attachment number 2
Page 12 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 13 | P a g e
Formatted: Centered
Employee participation in AWS is subject to management approval. In addition, supervisors may require
an employee's presence during specific hours for a certain period of time or a particular meeting.
Management may at any time alter a previously approved schedule to accommodate the requirement for
meetings, travel, training, conferences, and other essential work-related activities.
Augusta supports the concept of AWS which includes the use of all the approved options described in this
Section. The needs of the employees must be balanced with the ability of Augusta to accomplish its
mission. Department Directors are expected to work with employees to allow maximum flexibility
utilizing AWS, while at the same time ensuring the mission is accomplished. Augusta encourages
Department Directors to utilize a team-based approach in establishing AWS.
POLICY
Augusta supports and promotes Alternative Work Schedules that HQKDQFHWKHJRYHUQPHQW¶VFDSDFLW\WR
respond appropriately, effectively, and timely to daily work requirements and serve the needs of the
community.
Augusta management and eligible employees will adhere to the established procedures for requesting and
approving AWS in a way that accounts for overall performance of the agency and the accomplishment of
its mission.
$XJXVWD¶V$:6WDNHVLQWRDFFRXQWWKHVFKHGXOHVRI3XEOLF6DIHW\DJHQFLHVDQGDVVXUHVWKDWWKHUHLV
adequate coverage during official operational hours and in times of emergency.
Procedures for emergency situations and communication plans must be clearly delineated by the
respective Public Safety Department to ensure adequate coverage in times of emergency.
Proper record maintenance, certification and timekeeping procedures and processes must be clearly
delineated and adhered to.
A. Program Structure/Elements
1. Flexible Schedules: The basic work requirement for a full-time employee will consist of 7.5 hours
in a day, 37.5 hours in a week, and 75 hours in a biweekly period.
2. Compressed Schedules: A full-time employee must work 75 hours in a biweekly period but may
be scheduled to work fewer than 10 workdays.
3. In (1) and (2) above, the biweekly period must coincide with the pay period.
4. Overtime, Holiday, and Compensatory Time: Overtime must be requested and authorized by
supervisors in advance. If an employee is required by management to work hours which are in
excess of forty (40) hours, such hours must be compensated as either compensatory time or
overtime in accordance with the premium pay provisions of Title 5 and Title 38 of the United
States Code and the overtime provisions of the Fair Labor Standards Act.
5. Lunch Periods: The official lunch period is 1 hour, but may vary by Department. Employees
may not skip lunch time in order to leave work early without the prior approval of the Department
Director. The schedules described below are referring to working hours and do not include the 1
hour lunch break.
Attachment number 2
Page 13 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 14 | P a g e
Formatted: Centered
6. Work Schedule Designations: All work schedules must be approved/disapproved by the
Department Director or his/her designee.
7. Time Accounting: Employees will report their time and attendance in accordance with the
requirements of the Department Director.
8. Training: Employees attending conferences or training courses will be guided by the schedules
for conferences or training courses and alter their FWS accordingly. This normally will involve
reverting to the normal workday schedule. Training courses or conferences will not alter the
requirement for all employees to account for their approved work schedule.
B. Alternative Work Schedule Options
1. Authorized flexible schedules
a. Flexitour: This schedule allows an employee to select arrival and departure times within a
flexible time band; however, once selected, the hours become the employee's regular work
schedule.
b. Types of Hours: Core and flexible hours will be observed in the establishment of flexible
work schedules.
i. Core Hours are those hours when all full-time employees on flexible schedules must be
on duty during their scheduled workdays or in an appropriate leave status (including credit
hour time off). The Augusta core hours are 9:00 a.m. to 11:00 a.m. (morning core band)
and 1:00 p.m. to 3:30 p.m. (afternoon core band), Monday through Friday. Meetings are to
be scheduled during core hours unless it is not feasible to do so. Also, with prior approval,
lunch breaks may be used during core hours. Part-time employees continue to work
originally appointed hours unless the employee and supervisor agree on changes.
ii. Flexible hours are those hours of the workday within which the employee has the option
to select and/or vary the arrival and departure times. The Augusta flexible hours are 5:00
a.m. to 9:00 a.m. (Morning flex), 11:00 a.m. to 1:00 p.m. (Midday flex), and 3:30 p.m. to
8:00 p.m. (Evening flex band), Sunday through Saturday. For employees on a flexitour
schedule, the midday flex band allows employees to extend their lunch periods up to an
additional 1 hour and add the extra time at the end of the day. For example, an employee
can begin work at 6:30 a.m., take an 1 1/2 hour lunch (or personal) break and end work at
3:30 p.m.
2. Authorized compressed schedules
a. 4-Day Workweek: This schedule allows employees to work 37.5 hours a week, with 1 non-
workday each week of the pay period. Employees preselect fixed arrival and departure times
and two fixed non-workdays according to one of the following schedules: three 9.5 hour days
and one 9 hour day; or three 10 hour days and one 7.5 hour day. Starting times may be
scheduled between 6:00 a.m. and 9:00 a.m.
b. "5-4/9" Plan: This schedule allows exempt employees only to work eight 8.5-hour days and
Attachment number 2
Page 14 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 15 | P a g e
Formatted: Centered
one 7-hour day with 1 nonworkday each pay period. Employees preselect fixed arrival and
departure times and a fixed nonworkday. Starting times may be scheduled between 6:00 a.m.
and 9:00 a.m.
3. Restrictions
a. Employees must work or account for their basic work hour requirement by sick or annual
leave, compensatory time off, leave without pay, or excused absence.
b. Employees wishing to terminate their flexible or compressed schedule may do so at the end of
the current pay period. The schedule to which the employee will return will be approved by the
supervisor.
c. Employee requests to change to a different work schedule will be considered each calendar
quarter. Such requests must be submitted at least two full pay periods before the start of the
quarter and, if approved, will be effective at the beginning of the first pay period after January
1, April 1, July 1, or October 1 of each year.
d. While supervisors are expected to make every effort to schedule meetings and other special
activities during core times, there may be times when a supervisor will ask an employee to
arrange his/her schedule to meet program needs. When possible, the employee will be given
advance notice of the special need. If a supervisor determines that the work schedules within
an organization are adversely affecting the ability of a group or unit within the organization to
accomplish the work efficiently and/or provide service to the public and/or the schedule
increases significantly the cost of the operations, the supervisor may adjust employees' choices
of arrival and departure times, adjust the use of credit hours, or explore other options,
including discussions with the work group, prior to terminating an individual from
participating in AWS.
4. RESPONSIBILITIES
a. Human Resources Department
Human Resources staff maintains up to date information about policies, rules and regulations
related to work schedules. HR provides information to staff, management and supervisors
about changes that impact employees and the agency as a whole. HR provides guidance on
how to best comply with policies, rules and regulations related to work schedules of Augusta.
b. Department Directors
i. Department Directors approve or disapprove a flexible or compressed work schedule
within a department only after a consultation with the immediate work group. A proposed
schedule should be disapproved only if it would have an adverse impact on the mission
(e.g., a reduction in productivity, a diminution in the level of service to our customers, or a
documentable increase in the cost of operations).
ii. Department Directors plan and organize assignments to provide work and measurement of
accomplishment during the employee's hours. AWS provides greater freedom for all
employees to choose their working hours. There will be no routine overtime or
compensatory time granted in order to provide adequate supervision or telephone
coverage; needs should be anticipated and schedules made accordingly. Supervisors must
Attachment number 2
Page 15 of 269
Item # 11
Attachment number 2
Page 16 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 17 | P a g e
Formatted: Centered
Holidays that occur during vacation or sick leave shall not be charged against vacation or sick leave.
Contract, temporary and part-time employees will not be paid for holidays not worked.
Full-time employees, other than Public Safety, scheduled to work on an official Augusta, Georgia holiday
shall be paid at a rate one and one-half times the regular rate for each hour worked during the actual
holiday, LQDGGLWLRQWRWKHHPSOR\HH¶VKROLGD\SD\.
Section 100.007 Annual Leave/Sick Leave Accrual
Vacations are for rejuvenating both physical and mental faculties and all employees are urged to avail
themselves of vacation periods. Annual Leave (AL) may be used for vacations and personal use.
Eligibility for Annual Leave:
Full-Time Employees. All full-time employees shall be entitled to earn and accrue paid time off.
Temporary and part-time employees. Temporary and part-time employees shall not be eligible
for Annual Leave or Sick Leave.
Eligible non-SES employees begin to accrue Leave immediately upon employment and will be entitled to
take Annual Leave upon completion of six (6) months of employment. SES employees shall begin to
accrue Leave immediately upon employment and will be entitled to take Annual Leave immediately upon
accrual.
Leave Accrual: No accrual of AL or SL is allowed while on leave of absence without pay, while
suspended, or while on workers' compensation or salary continuation in lieu of workers' compensation.
Earnings Rate for Annual Leave and Sick Leave Accrual for non-SES regular employees (excluding Fire
Suppression personnel).
Years of
Service
Monthly Total
Annual Leave
(AL)
Monthly
Total Sick
(SL)
Total Annual
AL
SL
0-1 year 4 Hours 8 Hours 48 96
1-3 years 8 Hours 8 Hours 96 96
3-5 years 10 Hours 8 Hours 120 96
5-10 years 12 Hours 8 Hours 144 96
10-15 years 14 Hours 8 Hours 168 96
15+ 15 Hours 8 Hours 180 96
Employees, who leave Augusta, Georgia and are then rehired within one year, will be eligible to count
past years of service when applying this policy, provided they gave appropriate notification of resignation
and worked out their notice. Persons rehired after one year has passed will be treated as a newly hired
employee with no credit for previously worked time.
Attachment number 2
Page 17 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 18 | P a g e
Formatted: Centered
Section 100.008 Fire Suppression Personnel Paid Leave Policy
Fire Suppression Personnel begin to accrue Annual Leave/Sick Leave (AL/SL) immediately upon
employment and will be entitled to take vacation upon completion of six (6) months of employment.
Vacation may be taken as earned or may be allowed to accumulate in an amount not to exceed 288 hours
per year.
Accrual Schedule Hours Hours Per Year Days Per Year
0-12 Months 3.69 hrs/pay period 96 4
13-60 Months 4.62 hrs/pay period 120 5
61-120 Months 5.54 hrs/pay period 144 6
121-180 Months 6.46 hrs/pay period 168 7
181-240 Months 8.31 hrs/pay period 216 9
240 + Months 11.08 hrs/pay period 288 12
All vacation for fire suppression personnel will be taken between January 1 and December 20 of each
year.
Fire Suppression Personnel accrue sick leave at the same rate as all other regular, full-time employees as
described in Section 100.007 herein. Fire Suppression Personnel accumulate and carry over a maximum
of 1,518 hours of sick leave.
In lieu of the regularly scheduled holidays received by other employees, Fire Suppression Personnel will
be granted one hundred twenty (120) hours of Holiday Leave per year. Holiday Leave may be used by an
employee upon completion of six (6) months of employment.
Scheduling and use of AL, SL and Holiday Pay, including for illness, must be done in accordance with WKH )LUH 'HSDUWPHQW¶V SROLFLHV DQG SURFHGXUHV Fire Suppression Personnel must take vacation in
increments of twenty-four (24)-hour shifts. All vacations and personal use of Annual Leave must be
scheduled by December 31st of the previous year.
Section 100.009 Scheduling Annual Leave
Requests for annual leave usage will first be scheduled in the best interest of the department and,
secondly, at the employee's convenience. The Department Director must decide to approve or disapprove
annual leave in advance.
Section 100.010 Request for Annual Leave
A request for annual leave by any employee, other than a Firefighter, shall be submitted to the employee's
immediate supervisor within a reasonable time (normally not less than two (2) weeks, except in the case
of illness) in advance of the beginning date of the leave of absence and shall be made in accordance with
the current policies and procedures of the department. Leave must be scheduled and approved by the
appropriate supervisor in advance according to this Manual. Leave may be taken only after approval by
the appropriate Department Director so that, insofar as practicable, the department can function without
the hiring of additional temporary help. Leave shall be authorized in units of days or hours only. Leave
taken outside the guidelines for approval is considered to be unscheduled leave and may result in a charge
RIDEVHQFHZLWKRXWRIILFLDOOHDYH $:2/ GLVFLSOLQDU\DFWLRQDQGRUDGYHUVHO\DIIHFWDQHPSOR\HH¶V
Attachment number 2
Page 18 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 19 | P a g e
Formatted: Centered
performance review. The determination of the Department Director on the matter of scheduled annual
leave shall be final.
Section 100.011 Maximum Allowable Annual Leave Carryover
The maximum allowable Annual Leave that may be accrued and carried into the next calendar year for all
employees (except SES Employees), including Fire Suppression personnel, is two hundred and eighty-
eight (288) hours. When extreme operational matters and/or emergencies occur and the employee had
requested leave and the leave had been approved, an extension may be granted to use the leave at a later
time. The extension to use this approved leave shall be granted by the Administrator. Employees who are
granted this extension shall have ninety (90) days from the date of approval by the Administrator to take
the leave or it will be forfeited. It is the intent of these rules to have employees take their Annual Leave
during the calendar year of accrual.
Section 100.012 Payment for Unused Annual Leave
When an employee is separated from Augusta, Georgia, such employee shall be paid for all accrued
unused AL unless he/she fails to give proper notice of resignation or has failed to complete twelve (12)
months of continuous service excluding periods of LWOP.
Section 100.013 Rate of Payment for Annual Leave Following Promotion or Demotion
Employees using AL after the effective date of their promotion or demotion to a higher or lower job
classification shall receive annual leave pay at the rate in effect at the time the leave is taken.
Section 100.014 Annual Leave Buy-Back Policy
Purpose
To establish a program that allows annual leave to be converted to cash payments in lieu of taking time
off for all eligible employees of Augusta, Georgia. This program is contingent upon availability of funds,
with approval of the administrator.
Scope
This policy shall apply to all eligible employees serviced by Augusta, Georgia¶V +XPDQ 5HVRXUFHV
Department as described below.
Procedures
A. Any eligible employee may request to sell annual leave to Augusta, Georgia Human Resources
Department.
1. Eligible employees are
a. Full-Time
b. Employees who are eligible to accrue leave
2. Ineligible employee are
a. Contract employees paid by an agency other than Augusta, Georgia
b. (PSOR\HHVRIWKH6KHULII¶V'HSDUWPHQW
Attachment number 2
Page 19 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 20 | P a g e
Formatted: Centered
c. All employees of Constitutional Officers and/or Elected Officials that have officially
elected not to have their employees subject to Augusta, Georgia Policies and
Procedures.
d. The following extraordinary appointments
i. Temporary
ii. Part-time
B. An employee may sell a minimum of eight (8) hours and a maximum of forty (40) hours of AL per
fiscal year.
C. An employee must maintain a minimum Annual Leave balance of seventy-five (75) hours after the
leave is sold.
D. 2QFHVROGWKHDSSURSULDWHDPRXQWRI$/VKDOOEHSHUPDQHQWO\GHGXFWHGIURPWKHHPSOR\HH¶V
leave balance.
E. Requests to sell AL must be submitted through the Department Director to the Human Resources
Director, no later than November 1st of each year.
F. Payment for AL sold shall be included in the last payday on or before December 25th each year.
G. AL sale by any eligible employee is strictly voluntary.
H. The payout of any AL shall be contingent upon availability of funds as determined by the
Administrator.
Section 100.015 Scheduling of Sick Leave
Employees that need to use SL must notify their supervisor as soon as practicable of this need, but in any HYHQW QR ODWHU WKDQ WKLUW\ PLQXWHV DIWHU WKH HPSOR\HH¶V VFKHGXOHG VWDUW WLPH )DLOXUH WR QRWLI\
immediate supervisor of the need to use SL in a timely manner may result in any applicable day being
classified as AWOL. If an employee has requested SL for a period of three (3) consecutive working days,
or two consecutive shift schedules for Firefighters, a physLFLDQ¶VFHUWLILFDWLRQPXVWEHIXUQLVKHGWRSHUPLW
payment for SL. If there is a reasonable suspicion that an employee is abusing sick leave, he or she may
EHUHTXLUHGWRSUHVHQWDSK\VLFLDQ¶VFHUWLILFDWLRQIRUDQ\SHULRGRIWLPHIRUZKLFKVLFNOHDYHLVEHing
requested.
Section 100.016 Maximum Allowable Sick Leave Carryover
The maximum allowable sick leave that may be accrued and carried into the next calendar year for all
employees is nine hundred and ninety (990) hours, other than for Firefighters.
Section 100.017 Payment for Unused Sick Leave
Employees will not be paid for unused SL. Provided, however, that employees who are retiring and
would be eligible for retirement under the then governing retirement plan may be paid for up to half of
their accrued SL leave at retirement or may convert unused SL leave toward retirement credit, not to
exceed six (6) months.
Section 100.018 Sick Leave Pool Policy
Purpose 7KHSXUSRVHRIWKH(PSOR\HHV¶6LFN/HDYH3RROLVWRVXSSOHPHQWDQHPSOR\HH¶VORVVRILQFRPHGXULQJ
the transition period between full-time employment and an extended leave of absence, start of disability
retirement, or termination, resulting from that emplR\HH¶Vserious illness or injury. The Sick Leave Pool
can only be drawn after all Sick Leave and Annual LHDYHRQWKHHPSOR\HH¶VUHFRUGKDs been exhausted.
Attachment number 2
Page 20 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 21 | P a g e
Formatted: Centered
Background
The Sick Leave Pool is viewed as employment benefits to augment those leave benefits provided by
Augusta, Georgia. Such benefits apply to both exempt and non-exempt positions. These benefits do not
apply to employees who are not otherwise granted sick leave or annual leave under the Leave Policy.
Part-time, temporary or contract workers would not be eligible for participation in the Sick Leave Pool.
Section 100.019 Sick Leave Pool Eligibility
Eligibility criteria are as follows -
a. Membership is open to all eligible employees on a voluntary basis.
b. An employee must have been employed by Augusta, Georgia in a full-time regular position for
at least twelve (12) months preceding application for membership.
c. An applicant for membership in the Sick Leave Pool must have a minimum of seventy five
(75) unused Sick Leave hours at the time of application.
d. $SSOLFDQWVIRUPHPEHUVKLSVKDOODSSO\GXULQJ%HQHILWV³RSHQHQUROOPHQW´SHULRGDQQXDOO\
Section 100.020 $SSOLFDWLRQIRU0HPEHUVKLSLQ(PSOR\HH¶V6LFN/HDYH3RRO
a. An employee shall file an application for membership in the Sick Leave Pool with the Human
Resources Department GXULQJEHQHILWVDQQXDO³RSHQHQUROOPHQW´SHULRG.
b. The HR Department will certify that the applicant has or has not met all minimum eligibility
requirements for membership.
c. If the eligibility requirements have been met, membership shall become effective on the first
day of the month following receipt of the application for membership by the Human Resources
Department. Confirmation of membership will be sent by the HR Sick Leave Pool Coordinator
to the new member, along with a copy to the department.
d. Upon receipt of the membership confirmation, the HR Department will prepare a transfer of VLFNOHDYHIURPWKHHPSOR\HH¶VUHFRUGVWRWKH6LFN/HDYH3RRORQWKH&HUWLILFDWHRI7UDQVIHU)RUPEHDULQJWKHHPSOR\HH¶VVLJQDWXUHDQGGDWHVLJQHG7KHFRPSOHWHG&HUWLILFDWHRI7UDQVIHU
shall then be forwarded to the Payroll Department. A copy of the Certificate of Transfer Form
VKDOOEHJLYHQWRWKHHPSOR\HHDQGRQHPDLQWDLQHGLQWKHHPSOR\HH¶VSHUVRQQHOILOH7KH+5
Department shall be responsible for maintaining records on the Sick Leave Pool.
Section 100.021 Sick Leave Pool Contributions
a. The initial contribution will be fifteen (15) sick hours.
b. When the balance of the Pool falls below twenty (20%) percent of members contributions
(number of members times 8 hours), each member will be required to contribute four (4) hours
of sick leave from his or her official sick leave record (not to exceed twelve (12) hours in any
one fiscal year).
Attachment number 2
Page 21 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 22 | P a g e
Formatted: Centered
c. Should a member not have four (4) hours of sick leave on the books at the time the Pool is
replenished, he or she will be required to make replenishment upon accruing twenty (20) hours
of sick leave.
d. Should a member be in the process of applying for leave from the Pool at the time the Pool is in
need of replenishment, membership in the Pool shall be continued and replenishment shall be
waived until the member has returned to duty and has accrued twenty (20) hours of sick leave.
e. Any member who is currently drawing from the Pool may continue as a member until he or she
has drawn the maximum number of hours of sick leave (480 maximum) hours authorized. A
waiting period of one (1) year from last occurrence is required.
Section 100.022 Use of Pooled Sick Leave
Requirements for use of pooled sick leave (pooled leave):
1) Pooled leave will only EHXVHGIRUPHPEHU¶VLOOQHVVLQMXU\RUDFFLGHQW
2) All sick and annual OHDYHRQWKHHPSOR\HH¶VUHFRUGVKDOOKDYHEHHQH[KDXVWHG
3) The member shall request use of pooled sick leave on the appropriate form.
4) $ GRFWRU¶V VWDWHPHQWmust be provided as to the nature of the illness or injury, the
anticipated recuperation period required, and prognosis for recovery or return to work.
5) The Department shall provide the Human Resources Department with the request to use
pooled leave on the appropriate form, which shall include:
a) Date absence began;
b) Number of hours of absence to date;
c) Number of hours of Leave Without Pay (if any) during this period;
d) The employee is not an abuser of leave (e.g. employee does not show a pattern of
taking Fridays, Mondays, Days Before and After Holidays off);
e) 7KHDEVHQFHLVQRWIRUD:RUNHU¶V&RPSHQVDWLRQLQMXU\
f) &RS\RIGRFWRU¶VVWDWHPHQW
g) Attestation that the employee/member has no leave left; and has not exhausted 480
maximum hours of pooled sick leave within the past twelve (12) months;
h) Signature of Department Director; and
i) Number of hours requested up to a maximum of 480.
All requests to use pooled leave shall be reviewed and approved or denied by a majority of the Pooled
Leave Committee. The Committee shall approve requests on a priority of need basis. The number of
hours approved may be less than requested, after considering the reason for the request, the number of
Attachment number 2
Page 22 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 23 | P a g e
Formatted: Centered
requests being filed, and the balance of pooled leave available in the Pool.
If the request to use pooled leave is approved, members shall not be required to pay back the sick leave
awarded except upon investigation and finding of abuse of the Sick Leave Pool.
If the request to use pooled leave is denied, members shall have the opportunity to appeal the denial to the
Administrator. The ruling of the Administrator is final.
Section 100.023 Sick Leave Pool Committee
a. Each Department shall nominate one employee to serve on the Sick Leave Pool Committee.
b. Five (5) members (plus one alternate) will be selected by the Human Resources Department
(names drawn at random) from the above nominated employees to serve on the Sick Leave
Committee. The five-member Sick Leave Pool Committee will serve for a period of one year.
The Sick Leave Pool Committee shall meet as needed to review requests to use pooled sick
leave.
c. All Sick Leave Pool Committee members will be required to sign a confidentiality agreement
related to the administration of the Sick Leave Pool.
Section 100.024 Termination of Sick Leave Pool Membership
a. Members who choose to withdraw from participation may not withdraw their contributed leave
(or any prorated portion thereof).
b. A member who has utilized pooled sick leave and returns to work, may reapply to the Pool
when he or she again meets all eligibility requirements, e.g. one year after exhausting the 480
Pool Cap.
c. $PHPEHUZKRUHVLJQVIURP$XJXVWD*HRUJLD¶VHPSOR\PHQWDQGLVVXEVHTXHQWO\UH-employed
may reapply for membership in the Pool when he or she meets all eligibility requirements.
Membership shall be on a continuing basis unless the appropriate form signed and dated by the
employee/member requesting withdrawal is received by the Human Resources Department. Such request
shall be effective the first day of the month following receipt as indicated by receiving date stamped on
the face of the form by the Human Resources Department.
Section 100.025 Abuse of Sick Leave Policy
Allegations of abuse of sick leave drawn from the Sick Leave Pool by a member shall be confidentially
reported to the HR Director.
Should an investigation disclose abuse, the member may be expelled from membership in the Sick Leave
Pool and will be required to repay the amount of leave used. Other disciplinary action as determined by
the Department Director may also be taken.
Attachment number 2
Page 23 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 24 | P a g e
Formatted: Centered
Section 100.026 Military Leave
Augusta, Georgia provides military leave to employees in accordance with the Uniformed Services
Employment and Re-employment Rights Act of 1994 (USERRA) and Georgia law. USERRA provides
guidelines for employees who elect military leave and for the prompt reemployment of employees who
left employment to perform military training or service in one of the Uniformed Services and who have
completed such service under honorable conditions.
The Uniformed Services include the Armed Forces, the Army National Guard, and Air National Guard
when engaged in active duty for training, inactive duty training or full-time National Guard duty, the
commissioned corps of the Public Health Service, and any other category of persons designated by the
President in time of war or emergency.
A person who is a member of, applies to be a member of, performs, has performed, applies to perform, or
has an obligation to perform service in a Uniformed Service shall not be denied initial employment,
reemployment, retention in employment, promotion, or any benefit of employment by an employer on the
basis of that membership, application for membership, performance of service, application for service or
obligation.
Policy Details
REQUESTING LEAVE
Employees who enter the Uniformed Services are entitled to military leave of absence without pay for a
period not to exceed a cumulative total five (5) years not to include those periods of service exempted by
federal law (USERRA Regulations, 20 CFR & 1002.103).
The employee is required to provide notification to the department as soon as reasonably possible of the
need for military leave. In addition, the employee should contact Human Resources in order to complete
the appropriate leave form. If available, a copy of the appropriate military orders or other supporting
documentation for situations that do not warrant military orders should be attached to the appropriate
leave form. When written orders are not provided in advance of leave, the department may request the
orders upon return from leave.
DEPARTMENT DOCUMENTATION
All appropriate leave forms should be submitted to Human Resources at the time of the military leave
along with all supporting documentation placing the employee on military leave. This documentation
should include the military orders/supporting documentation when available and a letter to the employee
confirming the reason and dates of the leave.
USE OF LEAVE BALANCES
In accordance with federal law, employees are not required to use Annual Leave or Sick Leave for
military leave. However, employees may elect to use their Annual Leave or Sick Leave. Employees
electing to use accrued, unused Annual Leave or Sick Leave during a military leave must request in
writing to use unused Annual Leave or Sick Leave balances. Otherwise, the employee will take leave
without pay for the entire leave period.
Attachment number 2
Page 24 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 25 | P a g e
Formatted: Centered
To the extent that military leave is taken as paid leave, employees on military leave will continue to
accrue vacation and sick leave during the paid portion of the leave. Employees do not accrue sick or
vacation leave while on unpaid leave.
All periods of military leave without pay will be counted as credited service for all benefits that are based
on length of service, including service awards.
REEMPLOYMENT RIGHTS: GENERAL REQUIREMENTS
A. Employees who are absent from work for the reason of serving in the Uniformed Services, or for
the purpose of an examination to determine fitness to perform service in the Uniformed
Services, whether voluntarily or involuntarily, are entitled to reemployment rights and other
benefits if:
1. the periods of absence from Augusta, Georgia attributable to service in the Uniformed
Services do not exceed a cumulative total of five (5) years not to include those periods of
service expressly exempted from this five (5) year limitation by federal law (USERRA
Regulations, 20 CFR & 1002.103);
2. the employee is discharged under conditions that do not constitute other than honorable
discharge; and
3. the employee reports for or applies for reemployment according to the following time limits
(based on the length of the current military service from which the employee is returning):
a. Unless applicable law provides otherwise, employees whose period of Uniformed
Service is less than thirty-one (31) days must report to work on the first regularly
scheduled workday following eight (8) hours of rest time upon returning from the
place of duty.
b. Employees whose period of Uniformed Service was from thirty-one (31) days to
180 days must submit an application for reemployment no later than fourteen (14)
days after the completion of service.
c. Employees whose period of Uniformed Service was more than 180 days must
submit an application for reemployment no later than ninety (90) days after
completion of service.
d. Employees who, at the time of release from military service, are hospitalized for or
recuperating from an illness or injury incurred or aggravated during the Uniformed
Service must report for reemployment (if the period of military service was less
than 31 days) or apply for reemployment (if the period of military service was 31
days or more) at the end of the period necessary for recovery from the illness or
injury, provided the recovery period does not exceed two (2) years.
B. Documentation must be provided to establish timeliness of application, and to ensure that all
eligibility requirements for reemployment are met. Failure to provide documentation cannot be
used as a basis to deny reemployment if the requested information is not readily available through
no fault of the employee.
Attachment number 2
Page 25 of 269
Item # 11
Attachment number 2
Page 26 of 269
Item # 11
Attachment number 2
Page 27 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 28 | P a g e
Formatted: Centered
account of the employee's serious health condition will be treated as Family and Medical Leave. If FMLA
has been exhausted, the Administrator or HR Director upon recommendation of the Department Director
may specifically authorize the extension of leave without pay in accordance with the LWOP provisions of
this Manual.
Section 100.029 Maternity Leave
Maternity leave is a period of approved absence for incapacitation related to pregnancy and confinement.
Maternity leave may be charged to any combination of sick leave, annual leave, and leave without pay.
Maternity leave will be treated as Family and Medical Leave.
The employee desiring maternity leave should notify their Department Director. Such notification shall
include a written statement from the attending physician specifying the approximate date of birth.
An employee will be permitted to continue work so long as the conditions of the pregnancy do not
adversely impair work performance or health. Together, the employee desiring maternity leave and the
Department Director will determine the day maternity leave begins. The decision shall take into
consideration the written medical opinion of the employee's physician, the nature of the job in terms of
physical stress, and the employee's ability to perform normal job duties with full efficiency.
An employee shall be granted leave without pay for maternity purposes. Upon returning to work
following maternity leave, the employee must present to the Department Director a medical statement
from a certified physician stating that the employee has been released to return to work.
Section 100.030 Family and Medical Leave
Augusta, Georgia has adopted this policy to implement the terms of the Family and Medical Leave Act of
1993 (FMLA). Eligible employees are entitled to family and medical leave on the terms and conditions
stated in this policy, the regulations issued by the Department of Labor under the FMLA and in Augusta,
Georgia¶VRWKHUDSSOLFDEOHOHDYHSROLFLHV
A. Definitions:
For purposes of this policy, the following definitions apply:
1. ³(OLJLEOH(PSOR\HH´PHDQVDQLQGLYLGXDOZKRKDVEHHQHPSOR\HGE\$XJXVWD*HRUJLDIRUDWOHDVW
twelve (12) months, has worked at least 1,250 hours during the twelve (12) month period
immediately preceding the commencement of the requested leave.
2. ³)0/$/HDYH´PHDQVOHDYHWKDWTXDOLILHVXQGHUWKH)DPLO\DQG0HGLFDO/HDYH$FWRI DV
amended by the National Defense Authorization Act of 2008, Pub. L. 110-181, and the
'HSDUWPHQWRI/DERU¶VUHJXODWLRQVDQGLVGHVLJQDWHGE\$XJXVWD*HRUJLDDVVRTXDOLI\LQJ
3. ³/HDYH <HDU´ PHDQV WKHtwelve (12) month period measured backward from the date an HPSOR\HH¶VOHDYHFRPPHQFHG
4. ³6HULRXV+HDOWK&RQGLWLRQ´PHDQVDQLOOQHVVLQMXU\LPSDLUPHQWRU physical or mental condition
that involves either inpatient care or continuing treatment by a health care provider.
Attachment number 2
Page 28 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 29 | P a g e
Formatted: Centered
5. ³,QSDWLHQW&DUH´PHDQVDQRYHUQLJKWVWD\LQDKRVSLWDOKRVSLFHRU residential medical care facility,
including a period of incapacity or any subsequent treatment in connection with the inpatient care.
6. ³&RQWLQXLQJ7UHDWPHQW´LQFOXGHVDQ\RQHRUPRUHRIWKHIROORZLQJ
a. A period of incapacity of more than three (3) consecutive, full calendar days, and any
subsequent treatment or period of incapacity relating to the same condition, that also
involves:
i. Treatment by a health care provider two (2) or more times within thirty (30) days of
the first day of incapacity; or
ii. Treatment by a health care provider on at least one occasion, which results in a
regimen of continuing treatment under the supervision of a health care provider;
b. A period of incapacity due to pregnancy or prenatal care;
c. A period of incapacity or treatment for such incapacity due to a chronic serious health
condition;
d. A period of incapacity which is permanent or long-term due to a condition for which
treatment may not be effective; or
e. Any period of absence to receive multiple treatments by a health care provider for a serious
health condition.
7. ³&RYHUHG6HUYLFHPHPEHU´PHDQVDPHPEHURIWKH$UPHG)RUFHV including a member of the
National Guard or Reserves, who is undergoing medical treatment, recuperation, or therapy, is
otherwise in outpatient status, or is otherwise on the temporary disability retired list, for a serious
injury or illness.
8. ³&RYHUHG0LOLWDU\0HPEHU´PHDQVWKHHPSOR\HH¶VVSRXVHVon, daughter or parent on active duty
or call to active duty status.
9. ³$FWLYHGXW\RUFDOOWRDFWLYHGXW\´PHDQVGXW\XQGHUDFDOORURUGHUWR active duty (or notification
of an impending call or order to active duty) in support of a contingency operation as either a
member of the reserve components, or a retired member of the Armed Forces or Reserve.
10. ³6HULRXV,QMXU\RU,OOQHVV´LQWKHFDVHRIDPHPEHURIWKH$UPHG)RUFHV including a member of
the National Guard or Reserves, means an injury or illness incurred by the member in line of duty
on active duty in the Armed Forces that may render the member medically unfit to perform the
duties RIWKHPHPEHU¶VRIILFHJUDGHUDQNRUUDWLQJ
11. ³4XDOLI\LQJ([LJHQF\´PHDQVRQHRUPRUHRIWKHIROORZLQJ circumstances:
a. Short-notice deployment ± to address any issues that may arise due to the fact that Covered
Military Member received notice of the deployment seven (7) or less calendar days prior to
the date of deployment;
b. Military events and related activities ± to attend any official ceremony, program, or event VSRQVRUHGE\WKHPLOLWDU\WKDWLVUHODWHGWRWKH&RYHUHG0LOLWDU\0HPEHU¶VDFWLYHGXW\ RU
to attend family support or assistance programs and informational briefings sponsored by
the military;
c. Child care and school activities ± to arrange for alternative childcare; to provide childcare
on an urgent or immediate basis; to enroll or transfer a child to a new school; and to attend
Attachment number 2
Page 29 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 30 | P a g e
Formatted: Centered
meetings with school VWDIIWKDWDUHPDGHQHFHVVDU\E\WKH&RYHUHG0LOLWDU\0HPEHU¶V
active duty or call to active duty;
d. Financial and legal arrangements ± to make or update financial or legal arrangements UHODWHGWKH&RYHUHG0LOLWDU\0HPEHU¶VDEVHQFHZKLOH on active duty; and to act as the &RYHUHG0LOLWDU\0HPEHU¶V representative with regard to obtaining, arranging or appealing
military benefits;
e. Counseling ± to attend counseling sessions related to the Covered 0LOLWDU\ 0HPEHU¶V
deployment or active duty status;
f. Rest and recuperation ± to spend up to five (5) days with a Covered Military Member who
is on short-term, temporary rest and recuperation leave;
g. Post-deployment activities ± to attend ceremonies and reintegration briefings for a period
of ninety (90) days following the termination of the Covered 0LOLWDU\0HPEHU¶VDFWLYH
duty status; and to address issues arising from the death of a Covered Military Member ;
and/or
h. Other activities that Augusta, Georgia and employee agree qualify as an exigency.
B. Reasons for FMLA Leave:
An Eligible Employee is entitled to a total of twelve (12) weeks of unpaid leave during each Leave Year
in the event of one or more of the following:
1. The birth, adoption or placement for foster care of a son or daughter of the employee and to care
for such child. (Leave must be taken during the twelve (12) month period following the birth or
placement, and must be taken in a single consecutive period and may not be taken intermittently or
on a reduced schedule.)
2. A serious health condition of a qualifying family member, i.e. spouse, son, daughter or parent of
the employee, if the employee is needed to care for such family member.
3. A serious health condition of the employee that makes the employee unable to perform any one or
more of the essential functions of his or her job.
4. $Q\ ³TXDOLI\LQJ H[LJHQF\´ DULVLQJ RXW RIWKH IDFW WKDW DQ HPSOR\HH¶V spouse, parent, son or
daughter is on active duty or has been called to active duty in the Armed Forces in support of a
contingency operation.
An Eligible Employee is entitled to a total of twenty-six (26) weeks of unpaid leave during a single
twelve (12) month period to care for a parent, son, daughter, spouse or next of kin who is a Covered
Servicemember, regardless of whether the employee has taken leave for another FMLA qualifying reason
in the past twelve (12) months.
Any OHDYHWDNHQXQGHURQHRUPRUHRIWKHVHFLUFXPVWDQFHVZLOOEHFRXQWHGDJDLQVWWKHHPSOR\HH¶VWRWDO
entitlement to FMLA leave for that Leave Year.
C. Paid Leave Benefit Coordination with FMLA Leave:
FMLA leave under this policy is generally unpaid leave. If, however, the employee is eligible for any paid
leave under any other benefit programs such as Annual Leave or Sick Leave, the employee will be
required to exhaust the paid leave upon the commencement of, and concurrently with, FMLA leave
(unless the empOR\HH¶VRZQVHULRXVKHDOWKFRQGLWLRQKDVFDXVHGWKHOHDYHDQGWKHHPSOR\HHLVUHFHLYLQJZRUNHUV¶ FRPSHQVDWLRQ EHQHILWV 3DLG OHDYH ZLOO UXQ FRQFXUUHQWO\ ZLWK DQG EH FRXQWHG WRZDUG WKH
HPSOR\HH¶VWRWDOWZHOYH ZHHNRUWZHQW\-six (26) week period of FMLA leave. Employees on leave
Attachment number 2
Page 30 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 31 | P a g e
Formatted: Centered
WKDWTXDOLILHVERWKDVZRUNHUV¶FRPSHQVDWLRQDQG)0/$OHDYHZKRDUHRIIHUHGDOLJKWGXW\SRVLWLRQZLOO
have the option of remaining on FMLA leave without pay (and foregoing the light duty position and
DGGLWLRQDOZRUNHUV¶FRPSHQVation benefits) or accepting the light duty position. If the employee accepts WKHOLJKWGXW\SRVLWLRQWKHQWKHHPSOR\HH¶VULJKWWRMREUHVWRUDWLRQ DVGHVFULEHGEHORZ UXQVWKURXJKWKH
end of the applicable Leave Year. If the employee accepts light duty, then he or she retains the right to be
restored to the same position the employee held at the time his or her FMLA leave commenced or to an
equivalent position.
D. Intermittent or Reduced Scheduled Leave:
FMLA leave may be taken intermittently or on a reduced work schedule basis. If FMLA leave is taken
intermittently or on a reduced schedule basis, then Augusta, Georgia may require the employee to transfer
temporarily to an available alternative position with an equivalent pay rate and benefits, including a part-
time position, to better accommodate recurring periods of leave due to foreseeable medical treatment
Every employee is obligated to make a reasonable effort to schedule medical treatment so as not to unduly
interrupt Augusta, Georgia operations. Any employee who needs an intermittent or reduced schedule
leave shall submit an application for such leave on a form supplied by Augusta, Georgia at the time
described above. The employee shall also, within the time limits set forth, furnish Augusta, Georgia with
the proper medical certification on Form WH-380-E, which will be supplied by Augusta, Georgia,
regarding the need for such intermittent or reduced schedule leave. As in the case for other FMLA leaves,
Augusta, Georgia may require a second or third medical certification. Prior to the commencement of any
intermittent or reduced schedule leave, the employee requesting intermittent or reduced scheduled leave
must advise Augusta, Georgia of the reasons why the intermittent/reduced scheduled leave is necessary
and of the schedule for treatment, if applicable. The employee and Augusta, Georgia shall attempt to work
RXW D VFKHGXOH IRU VXFK OHDYH WKDW PHHWV WKH HPSOR\HH¶VQHHGV ZLWKRXW GLVUXSWLQJAugusta, Georgia
operations.
E. Employee Notice Requirement:
Employees are required to provide Augusta, Georgia with sufficient information to make it aware that the
employee needs FMLA-qualifying leave, and the anticipated timing and duration of the leave. Sufficient
information may include the following: that the employee is unable to perform his or her job functions; WKDWWKHHPSOR\HH¶VIDPLO\PHPEHULVXQDEOHWRSHUIRUPKLVRUKHUGDLO\DFWLYLWLHV WKDWWKHHPSOR\HHRU
his or her family member must be hospitalized or undergo qualifying continuing treatment; or the
circumstances supporting the need for military family leave. When an employee seeks leave due to a
FMLA-qualifying reason for which Augusta, Georgia has previously provided FMLA-protected leave, the
employeHPXVWVSHFLILFDOO\UHIHUHQFHWKHTXDOLI\LQJUHDVRQIRUWKHOHDYHDQGWKHQHHGIRU³)0/$´OHDYH
If the need for leave is foreseeable, the employee is required to provide such notice to the Human
Resources Department at least thirty (30) days before the commencement of the leave, unless
impracticable to do so under the circumstances, in which case notice must be given as soon as possible,
generally the same or the next business day. The employee also must follow any Augusta, Georgia policy
requiring advance notice, reasons for leave and anticipated start and duration of the leave. Failure to
provide advance notice or follow Augusta, Georgia policy when the need for leave is foreseeable may
result in delay or denial of FMLA leave. If the leave is not foreseeable, the employee must provide notice
to Augusta, Georgia of need for leave as soon as practicable, and must follow Augusta, Georgia¶VQRUPDO
call-in procedures, as set forth in Chapter 1 of this Manual. Failure to follow Augusta, Georgia¶VFDOO-in
procedures, absent unusual circumstances, will result in delay or denial of the leave. In case of planned
medical treatment for a serious health condition, the employee is required to make a reasonable effort to
Attachment number 2
Page 31 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 32 | P a g e
Formatted: Centered
schedule the treatment so as not to disrupt the operations of Augusta, Georgia.
Employees are required to give additional notice as soon as practicable whenever there is a change in the
dates of scheduled leave. Augusta, Georgia UHTXLUHVWKDWWKHHPSOR\HH¶VKHDOWKFDUHSURYLGHUFRPSOHWHD
fitness-for-duty certification that specifically addresses whether the employee is able to perform the
essential functions of his or her job before the employee can return to work. If Augusta, Georgia has a
³UHDVRQDEOH VDIHW\ FRQFHUQ´ LW PD\ DOVR UHTXLUH SHULRGLF ILWQHVs-for-duty certifications prior to the HPSOR\HH¶VUHWXUQIURPLQWHUPLWWHQW)0/$OHDYHXSWRRQFHHYHU\thirty (30) GD\V$³UHDVRQDEOHVDIHW\FRQFHUQ´PHDQVDUHDVRQDEOHEHOLHIRIVLJQLILFDQWULVNRIKDUPWRWKHLQGLYLGXDOHPSOR\HHRURWKHUV
Upon receivLQJVXIILFLHQWQRWLFHRIDQHPSOR\HH¶VQHHGIRU)0/$-qualifying leave, Augusta, Georgia
will notify the employee of his or her eligibility to take FMLA leave within five (5) business days of the
request, absent extenuating circumstances. At this time, the Augusta, Georgia will also provide the
HPSOR\HHZULWWHQQRWLFHRIWKHHPSOR\HH¶VULJKWVDQGREOLJDWLRQVZLWKUHVSHFWWRWKHOHDYH DVZHOODV
providing copies of the required certification form).
F. Application and Medical Certification:
$OHDYHWRFDUHIRUWKHHPSOR\HH¶VRZQVHULRXVKHDOWKFRQGLWLRQRUWKHVHULRXVKHDOWKFRQGLWLRQRID
covered family member, must be supported by a medical certification completed by the health care
provider for the employee or the covered family member. A qualifying exigency leave or a leave to care
for a Covered Servicemember with a serious injury or illness must also be supported by a certification.
Augusta, Georgia will provide the proper certification to the employee for his or her respective leave
witKLQILYH EXVLQHVVGD\VRIWKHHPSOR\HH¶VUHTXHVWIRUOHDYH7KHHPSOR\HHPXVWUHWXUQDFRPSOHWH
and sufficient copy of the appropriate certification to Augusta, Georgia within fifteen (15) calendar days
of receiving the certification, unless it is not practicable. If the employee returns an incomplete or
insufficient certification, then Augusta, Georgia shall advise the employee in writing what additional
information necessary to make the certification complete and sufficient. In order to cure the deficiency,
the employee must then return a complete and sufficient certification to Augusta, Georgia within seven
(7) calendar days. If the employee fails to cure a deficiency in a certification, or fails to return a
certification, within the prescribed time period, Augusta, Georgia may deny the taking of leave.
An Augusta, Georgia UHSUHVHQWDWLYH RWKHU WKDQ WKH HPSOR\HH¶V GLUHFW VXSHUYLVRU PD\ FRQWDFW WKHHPSOR\HH¶VKHDOWKFDUHSURYLGHUWRFODULfy or authenticate the medical certification submitted for leave for
WKH HPSOR\HH¶V RZQ VHULRXVKHDOWK FRQGLWLRQRUWKH VHULRXV KHDOWK FRQGLWLRQ RI D IDPLO\ PHPEHU,I
Augusta, Georgia has reason to doubt the validity of a medical certification, the employee will be required
to obtain a second or third opinion at Augusta, Georgia¶V H[SHQVH )DLOXUH WR FRPSO\ ZLWK WKHVH
certification requirements will result in the delay, denial or termination of leave.
An employee who will be on a FMLA leave for more than one (1) week is required to call the Human
Resources Department weekly to report when and if the employee expects to return to work. Augusta,
Georgia PD\UHTXHVWUHFHUWLILFDWLRQDWDQ\WLPHGXULQJWKHFRXUVHRIWKHOHDYHIRUWKHHPSOR\HH¶VRZQ
serious health condition, if: (1) the employee requests an extension of leave; (2) the circumstances of the HPSOR\HH¶V FRQGLWLRQ DV GHVFULEHG LQ WKH SUHYLRXV FHUWLILFDWLRQ KDYH FKDQJHG VLJQLILFDQWO\ RU LI
Augusta, Georgia has reason to suspect that an employee on FMLA leave has fraudulently obtained the
FMLA leave. If desired by Augusta, Georgia, a second or third certification in the manner provided above PD\EHUHTXLUHG,IWKHHPSOR\HH¶VOHDYHWRFDUHIRUKLVRUKHURZQVHULRXVKHDOWKFRQGLWLRQRUWKDWRID
family member is expected to last more than thirty (30) days, Augusta, Georgia will require a new
FHUWLILFDWLRQIURPWKHHPSOR\HH¶VKHDOWKFDUHSURYLGHUZKHQOHDYHLVVFKHGXOHGWRH[SLUHRUHYHU\six (6)
Attachment number 2
Page 32 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 33 | P a g e
Formatted: Centered
months, whichever occurs earlier.
When Augusta, Georgia learns of an FMLA reason for leave after a leave has commenced under another
of Augusta, Georgia¶VSROLFLHVAugusta, Georgia will designate the leave as FMLA-qualifying from the
commencement of the leave. Employees are required to cooperate in providing Augusta, Georgia with
information needed to make this determination.
G. Continuation of Group Health Benefits:
Augusta, Georgia ZLOOPDLQWDLQWKHHPSOR\HH¶VFRYHUDJHXQGHUDJURXSKHDOWKSODQGXULQJWKHSHULRGRI
FMLA leave under the same terms and conditions as though the employee were actively working. During
the leave, the employee will be required to continue to make all premium payments that he/she otherwise
would have had to make if actively employed. Where feasible, Augusta, Georgia will advise the employee
concerning the necessary arrangements for such payments prior to the commencement of the leave. If the
employee fails to return to work following the expiration of FMLA leave for a reason other than a serious
health condition or circumstances bH\RQGWKHHPSOR\HH¶VFRQWUROAugusta, Georgia will be entitled to the
repayment by the employee of any premiums paid by Augusta, Georgia during the leave. Failure to make
timely premium payments may result in the termination of coverage.
An employee on F0/$OHDYHVKRXOGGHOLYHUSD\PHQWRIWKHHPSOR\HH¶VSRUWLRQRIVXFKSUHPLXPWRWKH
Human Resources Department prior to the first work day of each month. Failure to make prompt payment RIWKHHPSOR\HH¶VSRUWLRQRIVXFKSUHPLXPPD\UHVXOWLQWKHORVVRIPHGLFal insurance coverage for the GXUDWLRQRIWKH)0/$OHDYHEXWXSRQWKHHPSOR\HH¶VUHWXUQWRZRUNWKHPHGLFDOLQVXUDQFHZLOOEH
restored as of the date that the employee returns. If the employee does not return from FMLA leave or
returns to work, but does not remain an active employee for at least thirty (30) days, Augusta, Georgia
may seek to recover the amount paid for such insurance premiums from the employee. An employee on
FMLA leave shall be responsible for the payment of the full premium for all other insurance, pensions
and other benefits. Failure of the employee to pay the entire premium for such items shall result in their
lapse for the duration of the FMLA leave. If the employee returns from FMLA leave, all such insurance,
pension and other benefits shall be restored without any break in service.
An employee shall not accrue any credit toward vacation or other benefits based upon time worked for the
time that he or she is on FMLA leave.
H. Return to Work / Fitness-for-Duty Certification:
Consistent with Augusta, Georgia practice, before returning to work following a medical leave due to the HPSOR\HH¶V VHULRXV KHDOWK FRQGLWLRQ WKH HPSOR\HH ZLOO EH UHTXLUHG WR SUHVHQW D ILWQHVV-for-duty
certification from his or her health care provider that the employee is medically able to resume work and
to perform the essential functions of his or her job. If the date on which an employee is scheduled to
return to work from an FMLA leave changes, the employee is required to give notice of the change, if
foreseeable, to Augusta, Georgia within two (2) business days of the change.
Subject to the limitations below, an employee returning from FMLA leave will be restored to the position
of employment held when the leave commenced or to an equivalent position. Job restoration may be
GHQLHGLIFRQGLWLRQVXQUHODWHGWRWKH)0/$OHDYHKDYHUHVXOWHGLQWKHHOLPLQDWLRQRIWKHHPSOR\HH¶VSRVLWLRQ RU LI WKH HPSOR\HH TXDOLILHV DV D ³NH\ HPSOR\HH´ JHQHUDOO\ WKH KLJKHVW SDLG RI WKH
workforce). Key employees may be denied job restoration if it would cause substantial and grievous
economic injury to Augusta, Georgia, in which case the key employee will be notified of this decision.
Attachment number 2
Page 33 of 269
Item # 11
Attachment number 2
Page 34 of 269
Item # 11
Attachment number 2
Page 35 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 36 | P a g e
Formatted: Centered
10. No leave without pay may be granted or required for a period exceeding six (6) months, except
as required by law or authorized by the Administrator. Leave without pay cannot be extended
beyond (1) year.
11. Any and all Augusta, Georgia property in the possession of an employee who is placed on a
leave of absence for more than one (1) month shall be immediately returned to the appropriate
department by that employee.
Section 100.033 Absence without Leave (AWOL)
The absence of an employee from duty, including absence for a single day or part of a day, that is not
authorized by a specific grant of leave of absence under the provisions of these regulations shall be
deemed to be an absence without leave (AWOL). Any such absence shall be without pay and may be
cause for further disciplinary action.
An employee who is AWOL for three (3) consecutive days will be considered to have voluntarily
resigned his or her employment with Augusta, Georgia effective immediately.
Section 100.034 Leave of Absence With Pay (see items listed on the sections below)
The types of leave in Sections 100.034 through 100.041 shall be with pay unless otherwise designated by
the Administrator or the Augusta, Georgia Commission.
Section 100.035 Funeral Leave
An employee may be granted funeral leave, with pay, for up to three (3) consecutive working days (one
twenty-four (24) hour shift for Fire Suppression personnel) per occurrence for funerals and related
preparations and travel of immediate family members. Immediate family is defined as spouse, mother,
father, children, sister, brother, father-in-law, mother-in-law, daughter-in-law, son-in-law, brother-in-law,
sister-in-law, grandparents, and grandchildren. Notice of intent to utilize funeral leave should be provided
to the employee's immediate supervisor as soon as possible.
In the event of unusual circumstances, such as distance to be traveled by the employee, additional funeral
leave without pay may be authorized. A request for such additional leave must be submitted in writing,
along with an explanation of the circumstances, to the Department Director who will review the request
and make a recommendation to the Director of Human Resources, who will either approve or deny the
request.
Section 100.036 Jury Duty/Civic Duty Leave
An employee who is called for jury duty or receives a court summons to appear as a witness during
working hours (civic duty) will receive his or her full pay. A copy of the summons for jury or civic duty
that is received by the employee must be furnished to the Department Director before jury or civic duty
leave begins. Employees called for jury or civic duty are excused from reporting for work only for the
time required traveling to and from the Courthouse and the time actually on jury or civic duty. If the Court
releases an employee (other than a Firefighter) from jury or civic duty during normal work hours, he/she
must return to his or her department as soon as possible. The employee will retain any compensation paid
by the court.
Attachment number 2
Page 36 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 37 | P a g e
Formatted: Centered
Section 100.037 Special Meetings and Examinations
A type of paid leave granted to the employee to attend professional or technical institutes or conferences,
or such other meetings as may contribute to the effectiveness of service to the Augusta, Georgia Board of
Commissioners upon return to duty. Time off with pay shall also be granted to an employee for the
purpose of taking examinations and interviews for a position within Augusta, Georgia. Such leave shall
be considered Administrative Leave and not be charged againsWWKHHPSOR\HH¶VDFFXPXODWHGOHDYH
Section 100.038 Training and Education
An employee may be granted paid leave in order to secure special educational training directly DSSURSULDWHWRWKHHPSOR\HH¶VSRVLWLRQWRYLVLWRWKHUJRYHUQPHQWDODJHQFLHVRULn the approved manner to
achieve systematic improvement in the knowledge or skills required in the performance of individual or
department work. Such leave shall be considered Administrative Leave and not be charged against the HPSOR\HH¶VDFFXPXODWHGOHDYe.
Section 100.039 Excused Absences
An employee may be granted paid leave in limited situations due to emergencies, inclement weather,
facility utility outage, to participate in Augusta, Georgia sponsored training and activities (i.e., wellness
classes), Augusta, Georgia sponsored civic activities, and for the purpose of conducting an investigation
into allegations of impropriety on the part of the employee (suspensions with pay), and at other times.
Department Directors may approve up to two (2) hours of administrative leave. Any excused absence in
excess of two (2) hours must be approved by the Administrator in advance. Such leave shall be
considered Administrative Leave and QRWEHFKDUJHGDJDLQVWWKHHPSOR\HH¶VDFFXPXODWHGOHDYH
Section 100.040 Days of Mourning
An employee may be granted days of mourning as declared by the President, Governor, or Mayor of the
Augusta, Georgia Board of Commissioners. Such leave shall also be observed by the classified
employees as an excused absence leave day off with pay (i.e., employees who are required to work will
receive another Administrative Leave day off). Such leave shall be considered Administrative Leave and QRWEHFKDUJHGDJDLQVWWKHHPSOR\HH¶VDFFXPXODWHGOHDYH
Section 100.041 Emergency Leave
An employee may be granted paid leave for national, state, or local emergencies as declared by the
appropriate authority or by the President. Such leave shall be considered Administrative Leave and not be
FKDUJHGDJDLQVWWKHHPSOR\HH¶VDFFXPXODWHGOHDYH
Section 100.042 General Administrative Leave
An employee may be granted leave with pay if such leave is deemed to be in the best interests of Augusta,
Georgia government. Department Directors may approve up to two (2) hours of administrative leave
during a twenty-four (24) hour period. All other requests must be processed through the Human
Resources Director for review and recommendation to the Administrator for final approval. Such leave
shall be considered Administrative Leave and not be charged againVWWKHHPSOR\HH¶VDFFXPXODWHGOHDYH
Attachment number 2
Page 37 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 38 | P a g e
Formatted: Centered
CHAPTER II.
EQUAL EMPLOYMENT OPPORTUNITY
Section 200.001 Equal Employment Opportunity
Augusta, Georgia is an Equal Opportunity Employer. We value and respect the diversity of our
employees, directors, consultants, representatives, suppliers, vendors, customers, and communities. As
part of our culture of respect and appreciation we believe that people with varied backgrounds and
perspectives add vitality and creativity to Augusta, Georgia and we encourage diversity in the workplace.
To that end, we provide equal employment opportunities regardless of race, color, religion, national
origin, sex, age, disability, military service or status, veteran status, citizenship status, or any other
characteristic protected by federal, state, or local law. Augusta, Georgia is committed to providing equal
opportunity in all our employment and purchasing practices. We will hire, evaluate, transfer, compensate,
and promote employees based on skills and performance, and not on any unlawful consideration.
We respect the special needs of individual employees, including those who are pregnant or returning to
work after the birth or adoption of a child. Only in valuing diversity and committing to equal opportunity
practices will we be able to fully utilize the human and business resources available. At the same time,
we believe that by valuing diversity, we enable all to fully realize their potential. All Augusta, Georgia
employment decisions are to be based on business related, nondiscriminatory reasons.
Our commitment to equal employment opportunity includes a corporate intolerance of any form of
discrimination, sexual harassment, or any other type of harassment. Such behavior undermines the very
core of our creed and values. Additional processes have been issued for affirmative action, disability
accommodations, harassment in the workplace, and workforce diversity. Performance consistent with the
spirit and intent of these policies are expected of each employee and, in the case of management
employees, such performance will be evaluated as in any other job-related duty.
For Augusta, Georgia to be successful, our employees must also be successful, as contributors to Augusta,
Georgia¶VPLVVLRQDQGREMHFWLYHVDQGDVLQGLYLGXDOVDQGFLWL]HQV7KHUHIRUHLQDGGLWLRQWRSURYLGLQJD
safe and healthy workplace, we are committed to the development of their unique skills and capabilities.
We believe that new experiences on the job and involvement in work teams or special projects are
valuable development opportunities.
If you feel you are a victim of any form of discrimination, you have a right to voice your concerns. You
can tell your immediate leader, any member of management or the Equal Employment Opportunity office
at 706-826-4789. Retaliation against anyone who lodges a complaint in good faith is strictly prohibited
and will be subject to discipline up to and including termination.
Section 200.002 Discrimination and Harassment-Free Workplace
Our value of treating others with respect and dignity carries over to our policy against workplace
discrimination and harassment. We do not tolerate unlawful discrimination or harassment against an
employee or potential employee based on any legally protected category. Instead, we actively seek to
create a workplace that allows employees to feel respected and appreciated. Our efforts to achieve
diversity and equal employment are driven by more than compliance with the law.
Attachment number 2
Page 38 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 39 | P a g e
Formatted: Centered
Discrimination and harassing behavior are destructive to our culture and against our core values. We have
no tolerance whatsoever for unlawful discrimination or harassment based on race, color, religion, gender,
age, national origin, disability, military service or status, veteran status, citizenship status, or any other
characteristic protected by federal, state or local law.
Discrimination is any unfair or unfavorable treatment suffered by any employee because of the HPSOR\HH¶V LQFOXVLRQ LQ D SURWHFWHG FDWHJRU\ 7KH DUHDV RI HPSOR\PHQW ZKLFK PD\ EH DIIHFWHG E\
discrimination include, but are not limited to, compensation, promotions, recruiting, job evaluations, job
training, and hiring. Harassment is a form of discrimination. Harassment consists of unwelcome conduct,
whether verbal, physical, or visual, that is based upon any category protected by law. Harassing
behaviors may include, but are not limited to, racist, sexist, ethnic, or other derogatory comments, name-
calling, kidding, teasing, or jokes directed at one person or group belonging to a protected category.
Augusta, Georgia will not tolerate discriminatory or harassing conduct that affects pay or benefits, that
interferes with an individual's work performance, or that creates an intimidating, hostile, or offensive
working environment. Augusta, Georgia will not tolerate discrimination or harassment of employees by
anyone, including any supervisor, co-worker, vendor, client, customer, or visitor.
Any individual either experiencing or observing a suspected incident of discrimination or harassment
should report the incident to their supervisor, to any Department Head, or to the EEO Officer. If the
complaint involves the employee's supervisor, department director, or anyone else in a supervisory
position over the employee, the employee should report the incident to the Human Resources Department
or to the EEO Officer. Any manager who receives a report of discrimination or harassment must
immediately report it to the EEO Officer, but in any event no later than three (3) working days after
receipt of the complaint.
All complaints of discrimination and harassment will receive immediate attention. Augusta, Georgia's
policy is to investigate all such complaints thoroughly, promptly, and in an impartial manner. If such an
investigation reveals that the complaint is valid, Augusta, Georgia will administer disciplinary and other
corrective action as appropriate to stop the discrimination or harassment and prevent its recurrence. Such
disciplinary action shall include any corrective action deemed necessary, up to and including immediate
termination of employment. Discipline will be based on the seriousness of the offense. To the fullest
extent practicable, Augusta, Georgia will keep complaints, related investigations, and the terms of their
resolution confidential. Retaliation against reporters of harassment or individuals who cooperate with a
corresponding investigation is strictly prohibited and will result in discipline up to and including
termination.
Respect and dignity for others is the key to providing a discrimination and harassment-free workplace.
All Augusta, Georgia employees are responsible for helping to assure that we successfully avoid
discrimination and harassment and their effects.
Section 200.003 Disability Accommodation
Augusta, Georgia is committed to complying fully with the Americans with Disabilities Act (ADA) and
ensuring equal opportunity in employment for qualified persons with disabilities. All employment
practices and activities are conducted on a non-discriminatory basis.
Hiring procedures and provide persons with disabilities meaningful employment opportunities. Pre-
Attachment number 2
Page 39 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 40 | P a g e
Formatted: Centered
employment inquiries are made only regarding an applicant's ability to perform the essential duties of the
position.
Post-offer medical examinations are required only for those positions in which there is a bona-fide job-
related physical requirement. They are given to all persons entering the position only after conditional job
offers. Medical records will be kept separate and confidential.
Reasonable accommodations are available to all qualified employees with a disability, where their
disability affects the performance of essential job functions. All employment decisions are based on the
merits of the situation in accordance with defined criteria, not the disability of the individual.
Qualified individuals with disabilities are entitled to equal pay and other forms of compensation (or
changes in compensation) as well as equal treatment in job assignments, classifications, organizational
structures, position descriptions, lines of progression and seniority lists. Leave of all types will be
available to all employees on an equal basis.
Augusta, Georgia is also committed to not discriminating against any qualified employees or applicants
because they are related to or associated with a person with a disability. Augusta, Georgia will follow any
state or local law that provides individuals with disabilities greater protection than the ADA.
This policy is neither exhaustive nor exclusive. Augusta, Georgia is committed to taking all other actions
necessary to ensure equal employment opportunity for persons with disabilities in accordance with the
ADA, as amended, and all other applicable federal, state, and local laws.
Section 200.004 EEO Office Overview
Purpose and Scope
The purpose of this policy is to promote employment diversity and equality within the Augusta, Georgia &RQVROLGDWHG *RYHUQPHQW ³$XJXVWD *HRUJLD´ WKURXJK D GHGLFDWHG (TXDO (PSOR\PHQW 2SSRUWXQLW\
(EEO) Office. This policy is also intended to provide uniformity in the processing of EEO complaints.
These policies and procedures exclusively apply to EEO-related issues in connection with direct
employees (classified and non-classified) of Augusta, Georgia operating under the authority of the Mayor
and the Augusta, Georgia Commission and the employees of those Elected Officials who have opted into
the Augusta, Georgia Personnel Policy and Procedures Manual. In addition, these EEO policies and
procedures are only intended to address employment discrimination concerns which relate to race, color,
gender, pregnancy status, marital status, genetic information, national origin, age, religion, disability or YHWHUDQ¶VVWDWXV
EEO Office Statement
Augusta, Georgia provides equal employment opportunity to all qualified employees and applicants for
employment and does not discriminate on any basis prohibited by law, including without limitation: race,
color, gender, pregnancy status, marital status, genetic information, national origin, age, religion,
disability and YHWHUDQ¶VVWDWXV$XJXVWD*HRUJLDLVcommitted to providing equal employment in all of its
employment practices, including selection, hiring, assignment, reassignment, promotion, transfer,
compensation, discipline and termination. Therefore, it is the policy of Augusta, Georgia not to tolerate
illegal discrimination. Providing equal employment opportunities is a system-wide effort and the
responsibility of all employees, the EEO Office, Department Heads, Directors and the City Administrator.
Attachment number 2
Page 40 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 41 | P a g e
Formatted: Centered
EEO Office Philosophy and Motto
Augusta, Georgia believes in achieving diversity by building bridges between employees and PDQDJHPHQW7KLVEHOLHILVGHPRQVWUDWHGE\WKH((2RIILFHPRWWRRI³%XLOGLQJ%ULGJHVIRU'LYHUVLW\´
The EEO office promotes diversity by constructing and maintaining these bridges through the building
blocks of Education, Collaboration and Mediation. Specifically, Augusta, Georgia believes that diversity
can be achieved by educating the workforce about the importance of equal employment opportunity in all
employment practices, collaborating with management and employees to develop policies and procedures
that support diversity, and mediating disputes in a fair and expedient manner.
Section 200.005 EEO Office Mission
Ɣ Establishing and maintaining a diverse and representative workforce for Augusta, Georgia by
removing barriers and maximizing both individual and collective potential.
Ɣ (QVXULQJ$XJXVWD*HRUJLD¶VFRPSOLDQFHZLWKJRYHUQLQJ((2VWDWXWHVDQGUHJXODWLRQV
Ɣ Promoting equal employment opportunity in the Augusta, Georgia workforce by enforcing EEO
guidelines and laws which prohibit employment discrimination.
Ɣ Promoting a positive organizational understanding and awareness of cultural diversity within the
Augusta, Georgia workforce.
Implementing The Mission
The EEO Office will implement its mission through:
(A) Assisting employees and management in relation to EEO compliance; providing
information and data to management.
(B) Conducting diversity outreach and bridge-building to promote an appreciation of
multiculturalism.
(C) Providing EEO oversight and feedback during the hiring process.
(D) Maintaining federally-mandated reporting of workplace EEO demographics.
(E) Responding to federal EEOC Complaints and other EEO-related inquires.
(F) Working to promote accommodations and equal access for people with disabilities as
required under the ADA.
(G) Independently and directly reviewing Augusta, Georgia EEO data and testing results
generated by vendors.
(H) Advising departments to maintain internal EEO data directly related to their specific
department, as needed.
Attachment number 2
Page 41 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 42 | P a g e
Formatted: Centered
(I) Providing training, information and consultation for employees and supervisors in the
areas of equal employment opportunity and workplace diversity.
(J) Conducting multicultural recruitment initiatives to promote a diverse applicant pool of
qualified candidates, as needed.
Section 200.006 EEO Office Oversight and Jurisdiction
EEO Office Coverage
The official organizational name of Equal Employment Opportunity, Equal Opportunity Office, EEO, or
any similarly-phrased name shall be exclusively designated to this specific office.
The EEO Office will collaborate with employees, managers, and various departments to promote EEO
compliance, systemic inclusion, and diversity.
The EEO Office may mediate in organizational matters which directly connect to EEO laws and the
expansion of diversity. In addition, the EEO Office may become involved in matters relating to
organizational diversity, respond to inquiries by the Augusta, Georgia Commission, and serve as a
consultant to the Commission. In matters involving overall department-wide or organizational
investigations, the EEO Office will make recommendations for changes to the Commission after
consultation with the Administrator.
Augusta, Georgia employee EEO issues include:
1. Allegations of unlawful discrimination based on race, color, gender, pregnancy status,
marital status, genetic information, national origin, age, religLRQGLVDELOLW\DQGYHWHUDQ¶V
status;
2. Allegations of harassment, including sexual harassment, as defined under federal
employment laws and EEOC Guidelines; and
3. Allegations of retaliation for asserting legally protected rights.
The Augusta, Georgia EEO Office Policy and Procedures do NOT apply to:
1. General personnel matters and personality conflicts that the employee states or concedes
are not based on race, color, gender, pregnancy status, marital status, genetic information, QDWLRQDORULJLQDJHGLVDELOLW\UHOLJLRQYHWHUDQ¶VVWDWXVRU((2-related retaliation;
2. Issues or claims pending before any court;
3. Any adverse employment action that is not based on race, color,
gender, pregnancy status, marital status, genetic information, national origin, disability,
DJH UHOLJLRQ YHWHUDQ¶V VWDWXV RU ((2-related retaliation including but not limited to
termination, demotion, denial of a job interview, denial of promotion, reassignment,
department reorganizations, furlough, layoff from duties because of lack of work, or other
action resulting from a reduction in the work force or job abolition;
4. Elected officials and their direct-report employees (unless such elected official submitted a
Attachment number 2
Page 42 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 43 | P a g e
Formatted: Centered
written, signed notice opting into the Augusta, Georgia Personnel Policy and Procedures
Manual);
5. EEO issues alleged by organizations, business or companies outside of the Augusta,
Georgia Consolidated Government;
6. EEO issues or concerns alleged by the employees of vendors or contractors of the Augusta,
Georgia Consolidated Government.
7. Issues alleged by persons not employed with the Augusta, Georgia Consolidated
Government.
Section 200.007 EEO Office Access to Information and Data Collection
EEO-related demographic data collection and the retrieval of certain personnel/employee and
departmental files are essential to the organization and the mandate of the Augusta, Georgia EEO Office
to provide case investigations, Federal Government reporting data, agency profiles, and the analysis of
departmental and organizational progress. The EEO Office may request data via e-mail or hardcopy
correspondence. Data requests should be copied to the Administrator. In certain matters, the EEO Office
should (at the discretion of the EEO Office) independently obtain all EEO-related data in relation to the
organization directly from internal departments, vendors, and testing companies when such data contains
EEO-related information in relation to Augusta, Georgia. Therefore, Departments, managers, employees
and offices shall allow the EEO Office to obtain and maintain direct departmental and vendor access to all
EEO-related information, statistics, and testing data including, without limitation, applicant pool and
departmental demographic data. The EEO Office may require segments of information and/or past data.
Requested information may not necessarily be related to certain minority groups or protected classes of
individuals; the EEO Office is authorized to request and receive information pertaining to various groups
including non-protected categories in order to facilitate investigations, inquiries and disparagement
comparisons.
Requested information should be released as soon as it is generated by the department or agency, but no
less than five working days after the request is issued by the EEO Office. Request for departmental data
relating to more than two (three or more) employees should be copied to the Administrator. Departmental
responses for data should contain the race and sex of each employee listed. Each department shall
establish direct EEO-data access for the internal EEO Office by issuing initial release forms to vendors or
creating direct access at the request of the EEO Office. Unless otherwise requested by the EEO Office in
writing, all data should be sent to the EEO Office through confidentially-marked e-mail, confidentially-
marked and sealed interagency mail, or confidentially-marked and sealed departmental hand-delivery. No
fees or EEO generation requirements shall be assessed to the EEO Office for the collection of such data or
the replication of requested information.
Attachment number 2
Page 43 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 44 | P a g e
Formatted: Centered
Section 200.008 Guidelines for Assessing Educational Credentials in EEO Matters
In EEO-related cases where educational credentials are an issue, the Augusta, Georgia EEO Office has
adopted guidelines from the U.S. Government and recognizes degrees from schools that have received
accreditation from an accrediting body which has been approved by the U.S. Department of Education
(USDE) [www.ed.gov], the Council for Higher Education, the American Council on Education (ACE)
[www.acenet.edu], or the Association of Specialized and Professional Accreditors (ASPA) [www.aspa-
usa.org]. All accrediting agencies²regional, national, and specialized²that are recognized by the USDE
as reliable authorities regarding the quality of the programs and schools they accredit are listed on the
USDE website at: www.ed.gov/admins/finaid/accred/index.html. The central accrediting body for many
of the degree-granting institutions of higher education in Georgia is the Southern Association of Colleges
and Schools (SACS) [www.sacs.org].
Section 200.009 Filing an EEO Complaint
Employees of Augusta, Georgia may consult with the EEO Office on an informal basis to receive
information and consultation in relation to specific situations without filing a formal EEO complaint or
grievance. In addition, employees may withdraw a formal EEO complaint and seek mediation or an
informal resolution at any point in the process.
Formal complaints must be filed in writing and signed by the employee. Employees may request to have a
formal complaint issued orally and transcribed into written format by the EEO Office. An oral complaint
must be transcribed into written format, signed and then submitted by the complaining employee. The
employee is responsible for ensuring that their oral complaint is completed, signed, and submitted to the
EEO Office within ten days after filing the oral complaint. Once an employee files a written complaint, a
letter is necessary to effectuate the withdrawal of an internal EEO complaint.
The EEO Office reserves the right to conduct an investigation of any and all complaints: formal/informal;
written/oral; and pending/withdrawn. The EEO Office also reserves the right to conduct or continue an
investigation even in situations where the complaint is withdrawn.
Section 200.010 Complaint Inquiries and Investigations
All EEO office proceedings, inquiries, and investigations will be conducted under the direct management
and direction of the EEO Office. The EEO Office may initiate individual investigations, conduct
inquiries, or provide educational information, in employee concerns as deemed necessary by the EEO
Office. In cases of a formal investigation, a written notification of an EEO complaint or concern will be
VHQWWRWKHFKDUJHGHPSOR\HHWKHHPSOR\HH¶VLPPHGLDWHVXSHUYLVRUDQGWKH'HSDUWPHQW'LUector. The
notification will occur within thirty working days after a representative of the EEO Office and the
complainant have signed an EEO Complaint Form, but in any event, no later than the commencement of
the formal investigation. In cases where no individual supervisor can be identified, case results will be
directed to the Administrator.
Employees are encouraged to file an EEO complaint directly with the Augusta, Georgia EEO Office. If
submitted indirectly through Human Resources or a supervisor, the individual receiving the EEO
complaint should forward it to the EEO Office as soon as possible, but in any event, no later than three
working days after receipt of the complaint.
Section 200.011 Complaint Process
Attachment number 2
Page 44 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 45 | P a g e
Formatted: Centered
Stage One (Informal Resolution)
Many EEO-related matters arise from misunderstandings and failed communication. The EEO Office
encourages matters to be resolved at the lowest possible levels and at the earliest stage possible. When no
written complaint has been submitted to the EEO Office or the Department, employees may collegially
discuss the concerns directly with the individual or colleague involved in an attempt to clear up any
possible miscommunications that may exist. Attempting to use informal methods of conflict resolution GRHVQRWIRUIHLWWKHHPSOR\HH¶VULJKWWRPRYHIRUZDUGDWDODWHUGDWH ZLWKLQRQH-hundred and eighty days
of the last alleged act) with a formal written complaint if the matter is not resolved in an informal manner.
The EEO Office provides consultation to both employees and managers seeking approaches to resolve
issues in an informal manner. Collaborative EEO resolutions at the lowest possible levels and the earliest
time periods are strongly encouraged. The EEO Office promotes respectful communication as a viable
option for settling disputes. Informal complainants may seek an informal resolution as follows:
1. When no formal written complaint has been filed with the EEO Office, employees may
first discuss the concerns directly with the individual or colleague involved in an attempt to
clear up any possible misunderstandings;
2. If the matter is not resolved or the employee would prefer not to discuss the situation with
the individual involved, then the employee should take the next step and discuss their
concerns with their immediate supervisor; and
3. If the concern remains unresolved or at anytime the employee desires, the next step is to
schedule an appointment to discuss the matter with the Department Head.
Stage Two (Informal Mediation)
If efforts toward an informal resolution are unsuccessful at Stage One (Informal Resolution) or an
employee seeks to skip informal resolution, then a complainant is encouraged to contact the EEO Office to
request assistance with negotiating or mediating the dispute prior to filing a formal EEO complaint.
Employees may seek assistance from management and/or the EEO Office in order to schedule a mediation
meeting to discuss issues which relate to an informal EEO case. The EEO Office will assist in working to
bring about an equitable resolution for both parties through the process of informal mediation.
Stage Three (Formal Written Complaints)
If the informal resolution or mediation attempts between the parties do not result in a resolution of the
matter within twenty working days or the employee seeks to skip informal resolution, the complaining
party then has the option to request that the EEO Office conduct a formal investigation. The request for a
formal internal EEO investigation should be dated and issued in writing as soon as the employee is aware
of the conduct or knows that informal resolution is unsuccessful. The complainant is required to provide
sufficient facts and data to substantiate discriminatory allegations. According to Augusta, Georgia Policy,
the EEO Office will investigate complaint and attempt to conciliate the claim.
The charged party (one who is accused of a discriminatory act) will be allowed to review the written
allegations and to provide a written response to the charges within seven days after the review. After
reviewing the allegations, responses, and evidence from both parties, the internal EEO Office will make a
Attachment number 2
Page 45 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 46 | P a g e
Formatted: Centered
determination as to whether or not to proceed with further internal investigations.
Once a formal written complaint has been filed the matter has gone past the level of informal resolution.
At this stage, employees should not attempt to resolve a formal EEO complaint on a one-on-one basis or
confront an employee
(either the complaining employee or the accused) in relation to an EEO case that is either open or closed.
In cases where the EEO Office moves forward with an internal EEO investigation, witnesses, co-workers,
and management may be questioned. Both the accused and the complainant will have an opportunity to
present their responses.
Augusta, Georgia employees formally being accused of an EEO violation in writing have a right to the
following:
1. To not receive: an assumption of violation, disciplinary actions, unjustified job relocations,
unjustified assignment changes, a demotion or a termination merely based on an initial EEO
accusation and/or a written complaint that has not yet been investigated and had a case finding
issued;
2. To see the actual written charges submitted in the complaint;
3. To have seven days from the date of receipt of the written charges, to submit a response to the
EEO Office and have this data included as part of the case investigation; and
4. To receive the final case findings in writing and to have a date of final case closure.
EEO investigations are an internal-agency fact-finding process, not a formal hearing or a court trial.
Therefore, no part of the EEO inquiry may be recorded (by the accused, charging party or third party
witnesses) either by audio recording, transcription, or any other form. The EEO Office maintains the
right to keep the official record of all inquiry data. All related parties shall receive a complete version of
the final case finding. Usually, complete case findings are issued within thirty days of the filing of a
formal written complaint.
Section 200.012 Employee Relocation In Connection With A Pending EEO Case
If the matter under EEO investigation is not impacting the job duties of the work group at issue, managers
should allow employees (both the complaining party and the accused) to remain situated in the same
physical work location, job assignment and department during an EEO inquiry. At the request of either
party or if it becomes apparent the parties cannot remain in the same work environment during the course
of the EEO investigation, all reasonable efforts will be made to modify the work environment pending the
EEO investigation, including, but not limited to, shift change, relocation, or position modification.
Affected employees should be returned to their previous work environment, job, and/or department within
five days after a case is resolved, if appropriate. In cases where the employee will not be relocated back
to their same work assignment or location, both the employee and the EEO Office should be notified in
writing outlining the details of why the changes are being made. In such cases, the employee who
initially made the EEO complaint has a right to file an appeal with the EEO Office if the employee feels
that the changes are being made in retaliation to filing an EEO claim.
Attachment number 2
Page 46 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 47 | P a g e
Formatted: Centered
Section 200.013 Confidentiality
This section is intended to protect the rights of individuals who file a written EEO charge with the EEO
Office. Managers and all involved parties are expected to maintain the confidentiality of employees and
other individuals directly involved in the EEO complaint process, to the extent possible. This includes
confidentiality in relation to conversations, meetings, e-mails, written correspondence, final case-findings,
and resolutions. Confidentiality does not mean that the accused will not be informed of the pending
charges as the accused will be allowed to respond to allegations made by the complainant.
Confidentiality during an investigation will be kept as much as possible and to the extent that it does not
impede the investigation or a directive from the Augusta, Georgia Commission. Management, Human
Resources Management, Law Department, related individuals, and, in certain cases the Augusta, Georgia
Commission, may be advised of an investigation, have access to case information, asked questions in
relation to allegations, and receive updates and/or final outcomes.
Section 200.014 Honesty Code
The complainant or charging party must sign a statement indicating that the allegations in the EEO
complaint (either verbal or in writing) are honest, true, accurate, and not exaggerated. When issuing a
statement or answering questions in connection with an EEO inquiry, an employee must, to the best of
their knowledge and belief, be truthful in all of their oral and written responses. Individuals (including
complainants, accused parties, employees, administrators, witnesses, managers, supervisors, information
gatherers, persons submitting data and others) who fail to cooperate with the EEO Office, are found to
have provided false information, file a frivolous claim, or alter written data in relation to an EEO inquiry
or investigation will be subject to disciplinary action.
Section 200.015 Management and Employee Cooperation
All managers and/or employees connected to Augusta, Georgia are required to: (1) fully cooperate in EEO
investigations; (2) provide any information (written, e-mailed, or oral) connected to an EEO
investigation,;(3) make themselves available for questioning within five working days of a request for a
meeting from the EEO Office (if this is not possible, an alternative date and time should be submitted in
writing to the EEO Office); and 4) provide truthful and accurate statements to the EEO Office.
Supervisors should not presume any employee (either the accused or the complainant) to be guilty of
anything or institute disciplinary actions merely based on a pending EEO charge or case.
Employees, managers, and Department Directors are encouraged follow the chain-of-command and
procedures outlined in this policy in order to resolve any EEO-related concerns.
Section 200.016 Complaint Closure
At the conclusion of the investigation, the EEO Office will send its findings to the charging party and the
accused. The Department Director of the accused will be issued a letter of findings which may include
recommendations from the EEO Office. Generally, the finding will be issued within thirty working days
after filing a complaint. However, in some cases, the EEO Office may extend the investigation time
period. If the period of investigation is extended, all parties will be provided with written notification of
the new deadline to complete the investigation. During the investigation period, ongoing mediation and
support services may be provided by the EEO Office. Following each investigation, the EEO Office may
Attachment number 2
Page 47 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 48 | P a g e
Formatted: Centered
elect to forward additional recommendations to the Department Director, the Administrator, and/or the
Augusta, Georgia Commission for consideration. Recommendations to the Commission and/or the City
Administrator will be made at the discretion of the EEO Office or at the direction of the Commission.
Upon approval by the Commission and/or City Administrator, individuals found by the EEO Office to be
in violation of the equal employment opportunity policy shall be issued disciplinary action by the
Department Director in an amount congruent with the severity of the violation.
The Department Head or the highest level supervisor over the employee is required to initiate disciplinary
action within five working days of receiving a written finding and confirmation of an EEO violation and
do a follow-up letter to advise the EEO Office of the final actions taken at the departmental level. In
cases where systemic violations relating to a department are found, the City
Administrator, the Commission and the EEO Office shall collaborate to bring about corrective actions;
this shall not eliminate actions against individuals within the department found to be in violation of the
EEO policy. A written letter
of resolution will be issued by the EEO Office and sent to the complainant and the charged individual. In
certain cases where the EEO Office deems that the accused
may have more likely than not violated the EEO policy or which may pose specialized concerns, the EEO
Office may consult with legal counsel and/or seek a detailed legal case review in conjunction with the
final internal EEO case finding.
Section 200.017 Prohibition Against Retaliation
Complainants, employees, management, participants, EEO Officials, and witnesses are protected against
any form of organizational, administrative, or management retaliation due to, or in any part based on,
participation in an EEO complaint, inquiry, mediation and/or investigation. A manager may not cause an
adverse employment action or otherwise retaliate against an individual for filing a complaint of
discrimination or participating in a discrimination proceeding.
If employees believe they are being subjected to retaliation, they should notify the EEO Office in writing
as soon as possible of the alleged retaliatory act. The written notice should outline in detail the
allegations and dates of the specific retaliatory acts that the person believes are being done. Department
managers and any other employees and officials found to have committed verifiable acts of retaliation
against an individual in connection with an EEO case will be subjected to discipline as outlined in the
Employee Handbook.
While employees are protected from retaliation for filing EEO complaints, employees who knowingly file
completely unsubstantiated or falsified EEO charges are subject to disciplinary action as outlined in the
Employee Handbook.
Section 200.018 Final Internal Case Closure and Appeal Rights
The issuance of a final written case finding from the Augusta, Georgia EEO Office shall constitute the
end of all Augusta, Georgia discrimination inquiries, investigations and appeals from or on behalf of both
the complaining party and the accused.
In the event any employee files a Charge of Discrimination with the Federal Equal Employment
Opportunity Commission (EEOC) or any other federal or state regulating agency, a copy of such charge
shall be forwarded to the Law Department as soon as practical, but in any event, no later than three
Attachment number 2
Page 48 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 49 | P a g e
Formatted: Centered
business days after receipt of such charge so that the Law Department may execute necessary legal
obligations, including distributing litigation hold letters. Within five business days of receipt of the
Charge of Discrimination, the Law Department shall determine whether it shall conduct the investigation
and respond, or the EEO Office shall investigate and respond. Any response to such charge shall be
subject to Law Department review and approval prior to being submitted to the EEOC or other federal or
state regulating agency.
Section 200.019 Policy Updates, Jurisdiction and Other Matters
This policy updates and clarifies EEO-related systems, policies and procedures that were previously being
conducted for Augusta, Georgia. It shall be added as a section of formal policy to all current editions of
the Human Resources Employee Handbook and all HR and departmental policies and procedures (formal
and informal/verbal and written). HR and other departments are expected to acknowledge and adhere to
the EEO Policies and Procedures. HR does not have the jurisdiction to investigate EEO-related matters.
As to all matters that are not EEO-related, HR Policies and Procedures and/or the applicable City
Ordinance shall control. The EEO Policy shall override any internal departmental policies and procedures
in relation to EEO issues or complaints. This policy supersedes any prior policies or procedures in
connection with the Augusta, Georgia EEO Office.
Attachment number 2
Page 49 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 50 | P a g e
Formatted: Centered
CHAPTER III.
GRIEVANCES, DISCIPLINE, & APPEALS
Section 300.001 Objective
It is the practice of Augusta, Georgia to:
1. Provide fair, equitable, and timely grievance procedures for all regular employees;
2. Facilitate free discussion of employment concerns between employees and supervisors to foster
better understanding of administrative policies, procedures, and practices;
3. Promote reaching a fair and equitable decision and doing so in a climate of mutual understanding
and objective fact-finding; and to
4. Assure that those who file grievances are not retaliated against.
Section 300.002 Grievance Policy Scope
This grievance procedure applies to all regular full-time employees, with the exception of temporary
employees, some elected officials, and members of the Senior Executive Service (SES). Additionally,
contract employees and persons in Grant Funded positions are not covered.
Augusta, Georgia reserves the right to depart from this grievance policy in its sole discretion. All
employees are employed at will, and both they and Augusta, Georgia may terminate the employment
relationship at any time, with or without cause, without following any specific procedure.
Section 300.003 Grievance Policy Undertakings
No punitive, discriminatory, adverse, or retaliatory action shall be taken against any employee on account
of the filing of a grievance or an appeal unless such grievance or appeal is frivolous. Frivolous is defined
as a grievance or appeal that is completely unsubstantiated or falsified.
All employees involved in processing a grievance will work diligently to insure that all grievances are
handled fairly and expeditiously and that all required deadlines are met. Every effort shall be made to
resolve grievances at the lowest possible level in the Augusta, Georgia organization. Grievances shall be
resolved by making decisions that are best for the organization and employees. Not every grievance will EHUHVROYHGWRWKHHPSOR\HH¶VVDWLVIDFWLRQ, but each grievance will be investigated and the employee will
receive a response.
Department Directors shall be responsible for the administration of this grievance policy in their
respective departments.
Attachment number 2
Page 50 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 51 | P a g e
Formatted: Centered
Section 300.004 Grievance Policy Definitions
$³JULHYDQFH´LVDGLVDJUHHPHQWUHJDUGLQJ an interpretation and/or application of administrative rule,
regulation, policy, plan or procedure which exists under the personnel administration system of Augusta,
Georgia which an employee feels is unjust or unfair.
$³ZRUNLQJGD\´IRUWKLVSROLF\LVdefined as any day of business between workings hours of 8:00 a.m.
and 5:00 p.m. excluding Saturday, Sunday and Augusta, Georgia observed Holidays.
Section 300.005 Exclusions From the Grievance Procedure
1. Formal Disciplinary Actions (i.e. written warnings, PIPs, suspensions without pay, demotions, and
terminations) handled through the appeal process defined in the Appeal Section of this policy.
2. Complaints of Sexual Harassment (These allegations should be filed with and will be processed
according to the Policies and Procedures established by the Commission for the Augusta, Georgia
Equal Employment Office (EEO Office)).
3. Complaints of Discrimination (Allegations regarding discrimination based on race, age, sex,
national origin, religion, veteran status and disability should be filed with and will be processed
according to the Policies and Procedures established by the EEO Office).
4. Wage/compensation issues pertaining to pay or benefits; validity of established salary ranges of
the current Augusta, Georgia pay plan; or salary, title, or duties and grade of a position or job
evaluation.
5. Hours of work and work schedules or performance appraisals/ratings/performance standards.
6. Non-selection from a bona-fide referral list of qualified and/or highly qualified candidates
provided to the selecting official from HR.
Section 300.006 Grievance Policy General Provisions
Grievances may be initiated only by the employee concerned and may not be pursued without the affected HPSOR\HH¶VFRQVHQW
Repeated filing of grievances concerning the same issue which has been denied will not be considered.
The employee filing a grievance may, at any step in the procedure, request the assistance from the HR
Department or from an advisor/advocate of his or her choosing. If this advocate is a current employee, the
advocate must obtain his or her VXSHUYLVRU¶VSHUPLVVLRQWRSDUWLFLSDWH7KHDGYRFDWHFDQRQO\SUHVHQWRU
prepare for the panel hearing during the advocate¶s off-duty hours.
Supervisors or Administrators hearing a grievance are urged to call upon the HR Director for advice of
assistance in the appropriate interpretation of Augusta, Georgia rules and procedures.
This procedure is normally intended for the use of individual employees. Should a number of employees
Attachment number 2
Page 51 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 52 | P a g e
Formatted: Centered
file separate grievances on the same matter, such grievances may be combined. A final determination on
the combined grievance shall be binding on all such similar grievances, and a copy of the final
determination shall be provided to all complainants.
Any grievance shall be considered resolved at the completion of any step if all parties are satisfied or if
neither party appeals the matter to the next step of the procedure with the prescribed period.
Section 300.007 Presenting a Grievance
Grievances must be presented, in writing, to the appropriate supervisor/manager in the chain-of-command
within ten (10) working days from the date of the act or from the date the employee became aware of the
occurrence. Grievances submitted after this time are untimely and will not be considered. Grievances
must be submitted on the grievance form prescribed by the HR Director for this purpose.
If the supervisor does not comply with the time limits within a step of the procedure, the employee filing
the grievance may proceed to the next level of review. A supervisor who is not responsive to the time
limits set forth in this procedure maybe subject to disciplinary action.
Failure of the grievant to comply with established time limits shall constitute abandonment of the JULHYDQFHDQGDQH[KDXVWLRQRIVXFKHPSOR\HH¶VDGPLQLVWUDWLYHUHPHGLHVDVWRWKHLVVXHJULHYHG6LQFHLW
is important that grievances be resolved as rapidly as possible, time limits, as set forth in the previous
paragraphs, shall be considered a maximum and efforts shall be made to expedite the process.
If either party wishes to extend any time limit at any step a request for extension should be made in
writing to the Department Director, indicating justification for the request at least twenty-four (24) hours
prior to the deadline established for the various steps.
Section 300.008 Grievance Process
Step One: Immediate Supervisor
$XJXVWD*HRUJLD¶VSRVLWLRQLVWKDWLVVXHVDUHEHVWUHVROYHGZKHQWKHUHis open communication between
employees and supervisors. It is the responsibility of any employee who believes that he/she has a bona-
fide grievance to promptly discuss the issue with his or her immediate supervisor and attempt to resolve
the matter at this level. It is recommended that the employee verbally express the suggested solution.
The immediate supervisor shall give an oral response to the employee. Every reasonable effort shall be
made to resolve the problem at this step. If the employee is noWVDWLVILHGZLWKDVXSHUYLVRU¶VRUDOUHVSRQVH
or chooses to bypass this step, then the employee may proceed to step two.
Step Two: Chain of Command
The employee shall complete a written Employee Grievance Form and submit it to the immediate
supervisor within five (5) working days of the event that gave rise to the grievance or when the employee
first became aware of the issue. Upon receipt of a written grievance, the immediate supervisor shall
consult with their immediate supervisor (if appropriate) and immediately forward a copy of the grievance
to the Department Director. If there are other supervisory levels between the immediate supervisor and
the Department Director, (i.e. field supervisor, assistant director, etc.) these levels should participate in
resolving the grievance at this Step since the next step is the Department Director. The immediate
Attachment number 2
Page 52 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 53 | P a g e
Formatted: Centered
VXSHUYLVRUDQGRWKHUVXSHUYLVRUVLQWKHHPSOR\HH¶VFKDLQRIFRmmand shall enter their joint comments on
the Employee Grievance Form and return it to the employee within five (5) working days of receipt of the
JULHYDQFHE\ WKH HPSOR\HH¶V LPPHGLDWH VXSHUYLVRU :KHUH D JULHYDQFH FRQFHUQV WKH FRQGXFWRI WKH
immediate supervisor, the next supervisor in the chain of command may choose to respond at this step.
If the written response of the immediate supervisor and/or other supervisors does not satisfy the
complainant, the employee may proceed to the next level by presenting the grievance to the Department
Director within five (5) working days of receiving the step two response.
Step Three: Department Director
Upon receipt of a timely submitted step two exhausted grievance, the Department Director will conduct
whatever investigation they deem necessary as part of their review of the grievance.
Within ten (10) working days of having received the written grievance, the Department Director shall
submit a written response to the complainant. A copy of the response shall also be provided to the
VXSHUYLVRUVLQWKHHPSOR\HH¶VFKDLQRIFRPPDQGDWWKH'HSDUWPHQWOHYHODQGWRWKH+5'LUHFWRU
,IWKH'HSDUWPHQW'LUHFWRU¶VUHVSRQVHLVQRWDFFHSWDEOHWRWKHFRPSODLQDQWWKHFRPSODLQDQWmay request
that the Administrator (or appropriate designee) review the grievance through a request to the HR
Director. Such a request must be made on the Employee Grievance Form, within five (5) working days DIWHUWKHHPSOR\HHUHFHLYHVWKH'HSDUWPHQW'LUHFWRU¶VUHVSRQVH.
Step Four: Administrative Review
Upon receipt of a timely submitted step three exhausted grievance, the HR Director will investigate the
grievance and recommend a solution to the Administrator. The HR Director will have ten (10) workdays
to provide a recommendation to the Administrator.
7KH$GPLQLVWUDWRUPD\DFFHSWWKH+5'LUHFWRU¶VUHFRPPHQGDWLRQVFRQGXFWhis or her own investigation,
and/or hold an Administrative Review hearing. The Administrator or his or her designee will present a
final decision within ten (10) working days of receipt of the grievance from the HR Director. The
$GPLQLVWUDWRU¶VGHFLVLRQLVILQDO Such final decision shall be sent to the employee via U.S. Certified
Mail.
Section 300.009 Grievance Witnesses
The grievant and the department may call witnesses to testify at a grievance hearing. Falsifying a VWDWHPHQWLVFRQVLGHUHG³VHULRXVPLVFRQGXFW´DQGPD\UHVXOWLQWKHHPSOR\HH¶VVXVSHQVLRQRUVHSDUDWLRQ
from employment.
Section 300.010 Grievance Documentation
Once a grievance submitted to the Administrator has been resolved, all documentation associated with the
grievance will be forwarded to the Human Resources Department. Although grievance documentation is SDUW RI WKH HPSOR\HHV¶ UHFRUGV WKH GRFXPHQWDWLRQwill be maintained in a file separate from the
HPSOR\HH¶VRIILFLDOSHUVRQQHOILOHin the HR Department.
Attachment number 2
Page 53 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 54 | P a g e
Formatted: Centered
Section 300.011 Discipline
Purpose:
To establish a uniform, fair, and standardized means by which Augusta, Georgia may administer a
program of disciplinary procedures and guidelines.
Disclaimer:
1. Disciplinary action may be taken against an employee when a rule of Augusta, Georgia or the
Department is violated, when work performance is not satisfactory, when counter-productive
or inappropriate behavior is exhibited, or violation of lawful orders, work rules/standards,
organizational Standard Operating Procedures (SOPs), administrative rules, organizational
policies and procedures, ordinances, and/or statutes. A discipline program should exhibit
promptness, impartiality, consistency, and fairness, where employees know what to expect as
the result of certain behaviors on the job (See Recommended Guidelines for Disciplinary
Actions- Table I).
2. Augusta, Georgia generally follows a policy of progressive discipline. The purpose of a
progressive disciplinary procedure is to give the employee adequate notice and opportunity to
correct any deficiencies, and its focus is on prevention of future violations rather than on
punishment. The disciplinary action taken is normally to be the least serious action needed to
prevent future instances of inappropriate behavior. If inappropriate behavior continues, the
employee can expect further and more serious discipline. This policy does not restrict the
imposition of a suspension, demotion, or termination in matters that are outside the progressive
discipline policy.
Augusta, Georgia reserves the right to depart from this discipline policy in its sole discretion.
All employees are employed at will, and both they and Augusta, Georgia may terminate the
employment relationship at any time, with or without cause, without following any specific
procedure.
Types of Discipline:
The types of disciplinary action, in order of their severity, are:
A. Informal Discipline
1) Letter of Warning
A Letter of Warning is a type of informal disciplinary action and may be used to admonish
an employee for committing a minor violation. It is often used when verbal counseling,
admonishments, on the job training, and/or guidance has failed to provide the necessary FRUUHFWLYH DFWLRQ 7KH ³1RWLFH RI :DUQLQJ /HWWHU´ 6HH)RUP +5-ER 1) provides
documentation that the counseling occurred, outlining the shortcomings or violations and
then offering recommendations for improvement. Informal discipline documentation is
maintained at the department level.
Informal disciplinary actions are not subject to the grievance or appeals processes.
Attachment number 2
Page 54 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 55 | P a g e
Formatted: Centered
B. Formal Discipline
1) Written Reprimand
A Written Reprimand is an admonishment given to the employee in writing, and is always
placed in the official personnel file in Human Resources. This form of discipline is more
serious than a Letter of Warning, but less serious than a suspension. A Written Reprimand
often serves as the type of discipline given for a repeated offense of minor violations or for WKHILUVWRIIHQVHRIDPRGHUDWHO\VHULRXVLQIUDFWLRQ7KH³1RWLFHRI:ULWWHQ5HSULPDQG´
(See Form HR-ER II) will be completed by the Department Director and forwarded to +XPDQ5HVRXUFHVIRULQFOXVLRQLQWKHHPSOR\HH¶VRIILFLDOpersonnel file. If a Letter of
Warning or any other relevant disciplinary actions has been issued previously, a copy may
be attached as supporting documentation. The letter of Written Reprimand may be used to
support further disciplinary actions for a period no longer than three (3) years from the date
of receipt.
2) Performance Improvement Plans
The Performance Improvement Plan (PIP) is designed to facilitate constructive discussion
between a staff member and his or her supervisor and to clarify the work performance to be
improved. It is implemented, at the discretion of the supervisor and Department Director,
when it becomes necessary to help a staff member improve his or her performance.
A PIP will be conducted for period of ninety (90) days and must be approved by the
Department Director. If an employee shows improvement but not enough that the HPSOR\HHPHHWVWKHVWDWXVRI³VDWLVIDFWRU\´WKH PIP may be extended for a period of ninety
(90) days within a one (1) year cycle for a total of no more than two (2) PIP plans. If an
employee does not show improvement after the initial PIP or does not meet the status of ³VDWLVIDFWRU\´DIWHUWZR 3,3VWKH'HSDUWPHQW'LUHFWRUFDQUHFRPPHQGWKHHPSOR\He
for demotion or termination.
3) Suspension Without Pay
A suspension is the most severe form of discipline, short of demotion or termination, and
involves time off without pay. It is used when a written reprimand has not corrected the
inappropriate behavior or when an offense is more serious than that warranting a
reprimand. A suspension may last from one (1) to thirty (30) days depending on the VHULRXVQHVV RI WKH LQIUDFWLRQ $Q\ VXVSHQVLRQ VKDOO XWLOL]H WKH ³1RWLFH RI 3URSRVHG
'LVFLSOLQDU\$FWLRQ´IRrm (Form HR-ER III) and must be approved by the Department
Director, or equivalent, prior to issuance to the employee. A copy will be processed
through the HR Director.
4) Demotion With A Pay Reduction
Performance-Based Demotion
An involuntary demotion may occur based on poor performance and is appropriate where:
Attachment number 2
Page 55 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 56 | P a g e
Formatted: Centered
1. 7KH HPSOR\HH¶V LQDELOLW\ WR SHUIRUP FXUUHQW MRE GXWLHVKDV EHHQ GHPRQVWUDWHG
and documented LQWKHHPSOR\HH¶VUHFRUG through one or more PIPs;
2. 7KHHPSOR\HH¶VUHFRUGLVRWKHUZLVHVDWLVIDFWRU\DQGQRRWKHUDFWLYHUXOHYLRODWLRQV
exist, e.g. attendance, punctuality, etc.;
3. The employee is qualified for the lower grade or alternative position;
4. The employee has the ability, is qualified, and a vacancy exists, the employee may be
demoted to another position which may be in a lower pay grade or transferred to DQRWKHUMREZLWKLQWKHHPSOR\HH¶VIXQFWLRQDOXQLW DQG
5. The Director of Human Resources has provided final approval for a demotion.
If an employee has been promoted or transferred in the last year and the employee is not
performing at a level expected in the new job, then the employee may request to return to
the previous job or a job similar to the previous job and their salary will return to what it
was prior to the promotion or transfer. The availability of such a job may depend upon
mitigating circumstances, such as whether the job has already been filled within the same
department. Augusta, Georgia will assist the employee in finding a suitable job that
corresponds to their experience, skills, and knowledge. Should the job previously held by
the employee be filled and no other comparable position exists, the employee will be
placed on lay-off status until a comparable position may be found. However, if within six
(6) months a comparable position is not found the employee will be placed on permanent
lay-off status.
Performance-Based Demotions with pay reductions may be considered in cases where
moving the person out of their current position is more appropriate than termination.
Conduct-Based Demotions
An involuntary demotion may also occur based on poor or unacceptable conduct. With this
type of demotion, a Performance Improvement plan is not necessary or required.
1. Unacceptable personal conduct violations are outlined in the violations and
recommended disciplinary actions in Table I. These conduct violations may include
but are not limited to: personal conduct that disrupts work or the work
environment, jeopardizes the safety of persons or property, or creates other serious
disruptions in the workforce.
2. There are circumstances in which unacceptable or bad conduct could warrant
imposing disciplinary action that is more severe than suspension but less severe
than termination. An acceptable alternative disciplinary action for this type of
conduct can be demotion in lieu of termination.
Provided the employee is qualified, a funded vacancy exists, and the Department Director
believes that demotion would be a more appropriate disciplinary action than termination;
the employee may be involuntarily demoted to another position which may be in a lower SD\JUDGHRUWUDQVIHUUHGWRDQRWKHUMREZLWKLQWKHHPSOR\HH¶VIXQFWLRQDOXQLW,QHLWKHUFDVH
the demotion in pay and/or grade would require a minimum ten percent (10%) reduction in
base pay. Prior to demotion, the proposed action must be reviewed and approved by the
Director of Human Resources.
Attachment number 2
Page 56 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 57 | P a g e
Formatted: Centered
5) Termination
Termination from employment is the most severe form of discipline. It is normally used
when an employee has been disciplined repeatedly and commits yet another infraction. It
may also be used when the employee has committed any infraction that falls outside
progressive discipline, regardless of disciplinary history. For every termination the
³1RWLce of Proposed Termination´IRUPshould be filled out completely by the Department
Director and should be delivered to the HR Director for review and processing. The
request for termination will be approved/disapproved by the HR Director who will issue a
ILQDO³1RWLFHRI'HFLVLRQ´
Section 300.012 Discipline Guidelines and Procedure
1. An employee for whom formal disciplinary action (i.e. written reprimand, PIP, suspension,
demotion, or termination) is being considered should, when possible, be allowed notice prior WRLPSRVLWLRQRIVXFKDFWLRQE\WKHXVHRIWKH³Notice of Proposed Disciplinary Action´
form. The employee will have five (5) working days in which to respond in writing or orally
to the Department Director explaining why the action should not be taken. Failure to respond
within that period will not delay administering of the disciplinary action.
2. Suspensions (for any reason), terminations, and demotions are permanent actions and will be
retained in the official personnel file indefinitely.
3. Any disciplinary action recommending a suspension, demotion, or termination must be in
writing and must be approved by the HR Director prior to disciplinary action being imposed.
4. An effective discipline program is characterized by the uniform application of rules and
regulations. Generally, like offenses should result in similar disciplinary actions. At the same
time, the supervisor administering the discipline may consider additional factors such as years
of service and internal consistency.
5. It is recognized that similar offenses may result in different disciplinary actions, depending on
work history, circumstances, and the severity of the offense. For example, an employee who is FKDUJHGZLWK³DEVHQFHZLWKRXWDSSURYHGOHDYH´(AWOL) for a two-week absence may be
terminated while an employee who is charged with AWOL for a two-hour absence may only
receive a one-day suspension. Both employees are charged with the same offense, but receive
different disciplinary actions.
6. Other factors that may influence the severity of disciplinary action include, but are not limited
to, the following: WKHOHQJWKRIWKHHPSOR\HH¶VVHUYLFHWKHTXDOLW\RIWKHHPSOR\HH¶VVHUYLFH
the cost involved, and the cooperation of the employee in the investigation of the specific
incident. Ensuring that disciplinary actions are administered in a fair, consistent, and non-
discriminatory manner is ultimately the responsibility of the HR Director.
7. An employee may not be punished more than once for the same offense by any other
management official of Augusta, Georgia. Previous offenses may, however, be taken into
account when considering future discipline. Disciplinary actions by law enforcement or any
other outside agency does not prohibit Augusta, Georgia from also taking disciplinary action.
For example, if an employee is issued a citation by law enforcement during the investigation
Attachment number 2
Page 57 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 58 | P a g e
Formatted: Centered
RIDQ³DWIDXOW´DFFLGHQWWKLVGRHVQRWSURKLELWAugusta, Georgia from imposing disciplinary
action as well.
8. In determining the proper level of disciplinary action, which would be suitable to a particular RIIHQVH UHIHU WR WKH ³5HFRPPHQGHG *XLGHOLQHV IRU 'LVFLSOLQDU\ $FWLRQV 7KLVTable of
Guidelines (Table I) provides examples of misconduct but may not be all-inclusive. Augusta,
Georgia has the right to discipline an employee for offenses not specifically listed. If an act or
violation is of a very serious nature, intermediate levels of progressive discipline may be
bypassed with more severe penalties imposed.
9. In addition to a thorough narrative with any supporting evidence as necessary, supporting the
reason(s) for the charges or offense in question, the Department Director should cite any DSSOLFDEOH³9LRODWLRQ5HIHUHQFH´FRGHIRXQGRQWKHWDEOHRIJXLGHOLQHV (HR-ER Form). More
than one reference may be cited in making record of the disciplinary action. The specific
action or punishment to be taken is at the discretion of the Department Director; particularly
egregious violations may bypass the progressive discipline process.
Note: The Personnel Board shall consider only Appeals of employees as it relates of dismissals or
terminations. Decisions of the Personnel Board may be appealed to the Administrator.
Attachment number 2
Page 58 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 59 | P a g e
Formatted: Centered
Review and Approval Process
1. If the actions necessary are not time-sensitive, the supervisor shall notify the employee (Notice RI 3HQGLQJ 'LVFLSOLQDU\ $FWLRQ´ IRUP WKDW IRUPDO GLVFLSOLQDU\ DFWLRQ LH VXVSHQVLRQ
demotion, or termination, is being considered. This notification shall provide facts and a
description of the alleged infraction(s) and the consequences under consideration. The
employee shall be given five (5) working days in which to provide a written response to the
Department Director, with a copy to HR, showing cause as to why disciplinary action should
not be taken.
2. When a regular employee is charged with misconduct that serves as a basis for termination or
demotion, the Department Director may (but is not required to) place the employee on up to
three (3) days Administrative Leave with pay. The administrative leave will be unpaid if the
employee is otherwise unavailable to perform his or her job duties or if unpaid Administrative
Leave is approved by the HR Director.
3. Infractions of a serious nature may require prompt action, not allowing for advance
notification. Any written communication from the employee will permanently accompany the
relevant disciplinary action.
Formal
Discipline Submitter Approver Time to
Appeal 1st Appeal 2nd Appeal
Written
Reprimand
Supervisor/
Manager
Department
Director 5 Days HR Director None
PIP
Supervisor/
Manager
Department
Directors 5 Days HR Director None
1-3 Days
Suspension
Supervisor/
Manager
Department
Director
5 Days
HR
Director
None
4 Days or
more
Suspension
Department
Director
HR
Director
5 Days
Administrator
None
Demotion
Department
Director
HR
Director
5 Days
Administrator
None
Termination
Department
Director
HR
Director
5 days
Personnel
Board
Administrator
Attachment number 2
Page 59 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 60 | P a g e
Formatted: Centered
4. The Department Director must coordinate with the HR Director to assure procedural
compliance prior to issuance of any proposed or final decision. Within ten (10) workdays of
UHFHLSW RI WKH HPSOR\HH¶V ZULWWHQ UHVSRQVH WKH 'HSDUWPHQW 'LUHFWRU RUHR Director will GHFLGHDQGLVVXHWKHGLVSRVLWLRQLQWKHPDWWHUXVLQJWKH³Notice of Final Decision Form HR-(5,9´
5. 8SRQUHFHLSWWKHHPSOR\HHVKRXOGVLJQDQGGDWHD³5HFHLSW$FNQRZOHGJHG´RI1RWLFHRI)LQDO
Decision. A copy of all documentation associated with the case will be furnished by the
Department Director to the HR Department for filing in the Official Personnel File.
Section 300.013 Appeal of Submitted and Approved Discipline
1. In order to remain timely, the request from the employee for an Appeal to the HR Director,
Administrator or Personnel Board, must be written, signed and filed in the HR Department
within five (5) business days of the employee receiving notice of the recommended
disciplinary action, or Final Decision by the Department Director or HR Director. The effect
RIDQHPSOR\HH¶VIDLOXUHWRUHTXHVWDQAppeal within this five (5) day period is the waiver of
their right to appeal the recommendation, action or decision and a failure on their part to
exhaust their administrative remedies. In such instances, the recommendation for discipline
made by the Department Director (or manager) or the Final Decision made by the HR Director
shall become a Final Decision which is not appealable.
2. A written statement by the employee specifically referencing suspension, demotion, or
termination and providing their reasons, to include any relevant documentation, for
recommending the disciplinary action be overturned, shall be forwarded to the HR Director.
The HR Director will review the documents for timeliness and completeness and, if a timely
appeal is made, shall forward a copy of the request to the next appeal level within ten (10)
working days of receiving the request.
3. For suspensions of four (4) or more days, demotions, and terminations, the HR Director or
designee shall hold an administrative review conference at which time the employee shall be
authorized to present information that is pertinent to the charges on his or her behalf. (For
suspensions of 1 to 3 days, the Department Director or designee shall hold an administrative
review conference). If an employee wishes to have an attorney present at this conference, said
employee must inform the HR Director of such intentions at least forth-eight (48) hours prior
to the conference. The HR Director may seek legal representation from the Law Department
in any such conference or Personnel Board Hearing irrespective of whether the employee has
requested an attorney or not.
4. The HR Director, or designee (Department Director for suspensions of 1-3 days) shall render a
decision on the recommendation based on all of the relevant information. The +5'LUHFWRU¶V
RU 'HSDUWPHQW 'LUHFWRU¶V decision is final, and, the employee shall be notified of this
decision in writing.
Attachment number 2
Page 60 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 61 | P a g e
Formatted: Centered
Section 300.014 Appeals to the Personnel Board: Terminations Only
Note: Only full-time regular employees may appeal Terminations. SES and Probationary employees
may not appeal to the Personnel Board.
1. The employee shall have five (5) business days from notification by the HR Director to appeal
a termination or dismissal (Form HR-ER V) via the HR Department to the Personnel Board.
2. Upon receipt by the HR Director of a timely written request for appeal of termination by the
employee, Human Resources will, within ten (10) working days, submit all documentation,
including a statement of charges, to the Personnel Board.
3. At its next scheduled meeting, the Personnel Board will hold an open hearing and receive
evidence in relation to the Appeal in accordance with the bylaws of the Personnel Board.
4. If an employee wishes to have an attorney present at the Personnel Board hearing, said
employee must inform the HR Director of such intention at least forty-eight (48) hours prior to
the hearing. The HR Director may seek legal representation from the Law Department in any
Personnel Board Hearing irrespective of whether the employee has requested an attorney or
not.
5. Within ten (10) working days of the hearing, a written decision will be rendered by the
Personnel Board. Such decision shall contain a descriptive statement by the Chairman of the
Personnel Board describing the reasons the Board rendered the decision it made.
6. The HR Department will notify the employee in writing of the decision of the Personnel
Board.
Section 300.015 Personnel Board By-Laws
(A) Purpose. The purpose of these bylaws is to establish uniform procedures for the conduct of hearing
DQGPHHWLQJRIWKH$XJXVWD*HRUJLD3HUVRQQHO%RDUG KHUHLQDIWHU³3HUVRQQHO%RDUG´RU³%RDUG´
(B) General Provisions.
(1) After an appeal of a dismissal has been properly filed with the Human Resources Department, the
appeal shall be forwarded to the Chairperson of the Personnel Board to be scheduled for a hearing
before the Personnel Board.
(2) Notice of Hearing. Within seven (7) days from the filing of an appeal in accordance with the (PSOR\HH $GPLQLVWUDWLYH 3ROLF\ 3URFHGXUHV 0DQXDO KHUHLQDIWHU ³(PSOR\HH 0DQXDO´ WKH
Chairperson of the Personnel Board shall designate an appropriate time and place to conduct the
hearing and shall so notify all parties in writing. Such notification shall be mailed or served at
least ten (10) calendar days in advance of the date set for the hearing. The Personnel Board will
conduct an investigation into the charges based on the information provided by the Human
Resources Department. At its next scheduled meeting, the Personnel Board will hold an open
hearing and receive any additional evidence in relation to the Appeal. The Chairperson of the
Personnel Board, or a majority vote of the Board, shall have the authority to postpone or to
Attachment number 2
Page 61 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 62 | P a g e
Formatted: Centered
FRQWLQXHDKHDULQJ HLWKHULQWKH&KDLUSHUVRQ¶VGLVFUHWLRQXSRQDPRWLRQE\WKH3HUVRQQHO%RDUG
or upon the motion of either party, orally or in writing).
(3) Representation. Opportunity shall be afforded both parties to represent themselves or to be
represented by an attorney licensed to practice law in the State of Georgia. All arrangements for
providing legal counsel shall be the responsibility of the party desiring such representation. An
employee intending to have representation shall inform the Director of Human Resources of such
intentions at least 48 hours prior to the scheduled date of such hearing.
(4) Pre-Hearing Conference. The Chairperson of the Personnel Board may arrange a pre-hearing
conference for the purpose of reviewing the matter being appealed and establishing stipulations to
expedite the hearing.
(5) Witnesses.
(a) The appellant or the Human Resources Director (or his or her designee) may request the
attendance of employees or other persons as witnesses when their testimony will aid in
establishing the facts in the case. Employees appearing as witnesses shall be released from
duty without loss of pay or time and without effect on their service rating. However, the 3HUVRQQHO%RDUGGRHVQRWKDYHVXESRHQDSRZHUVWRFRPSHODZLWQHVV¶VDWWHQGDQFH
(b) No person shall directly or indirectly use, or threaten to use, any official authority or other
influence which would tend to discourage any other person from testifying.
(c) Each party shall provide the opposing party a witness list at least three (3) business days in
advance of a scheduled Personnel Board hearing. A party seeking to have a witness testify
that is not on their witness list may only do so with the consent of the opposing party.
(6) Record of Hearing. A recording shall be made of all hearings; however, such recording will
not be transcribed unless the Personnel Board decision is appealed in accordance with the
Augusta, Georgia Personnel Policies and Procedures Manual; or a transcript is requested by
the Personnel Board or either party to the hearing. If the employee requests a copy of the
transcript prior to appealing WKH3HUVRQQHO%RDUG¶VGHFLVLRQWKHHPSOR\HHVKDOOSD\WKHFRVWRI
having the recording transcribed. In addition to the recording of the hearing, or a transcription
thereof, all documents entered into the record during the hearing shall be made part of the
official record of the hearing. It shall be the responsibility of the clerk of the Personnel Board
to compile the official record of the hearing and, upon the filing of an appeal of the Personnel %RDUG¶VGHFLVLRQWRKDYHVXFKUHFRUGFHUWLILHGE\WKH&Kairperson of the Personnel Board.
(C) Hearing Process.
(1) Role of the Board. The Personnel Board shall have the authority to do the following in connection
with any hearing:
(a) To administer oaths and affirmations;
(b) Regulate the course of the hearing;
(c) Set the time and place for continued hearings and pre-hearing conferences;
(d) Reprimand or exclude from the hearing any person for any indecorous or improper conduct
committed in the presence of the Personnel Board;
Attachment number 2
Page 62 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 63 | P a g e
Formatted: Centered
(e) To make informal disposition of any case by stipulation, agreed settlement, consent order or
default, unless such disposition is precluded by law;
(f) To render a decision as to issues properly presented to the Personnel Board; and
(g) To file Answers to Writs of Certiorari properly filed in the Superior Court of Richmond
County.
(2) Attendance at the Hearing. Any hearing at which the Personnel Board receives evidence or hears
arguments on appeals of disciplinary actions, dismissals, or other purported violations of the rules
shall be open to the public in accordance with Georgia Open Meetings Law. Witnesses may,
however, be sequestered at the discretion of the Board.
(3) Evidence. With respect to all hearings before the Personnel Board:
(a) Irrelevant, immaterial or unduly repetitious evidence shall be excluded. The rules of evidence
as applied to the trial of civil non-jury cases in the Superior Courts of Georgia shall be
followed. Evidence not admissible there under may be admitted if it is of a type commonly
relied upon by reasonably prudent persons in the conduct of their affairs. The Personnel Board
shall give effect to the rule of privilege recognized by law;
(b) Objections to evidentiary offers may be made and shall be noted in the record;
(c) When a hearing will be expedited and the interest of the parties will not be prejudiced
substantially, any part of the evidence may be received in written form;
(d) Documentary evidence may be received in the form of copies of excerpts if the original is not
readily available; and
(e) The Director of Human Resources may proceed with the presentation of evidence first.
(4) Conduct of Hearings. In the hearing of an appeal, the proceeding shall be informal but orderly.
The following procedure shall prevail:
(a) The Chairperson of the Personnel Board shall open the hearing by explaining the procedure to
be followed in the hearing.
(b) Witness shall be sworn in and at the discretion of the Chairperson any or all witnesses may be
sequestered;
(c) The Chairperson shall read or cause to be read the charges and specifications of the issues to be
determined by the Personnel Board;
(d) The facts not in dispute may be stipulated;
(e) Each party shall be given an opportunity to make a brief opening statement identifying the
issues and indicating what is to be proven. The Human Resources Director shall present their
opening statement first followed by the employee;
(f) The Human Resources Director will begin its presentation of evidence followed by the
employee;
(g) All witnesses shall testify under oath or affirmation. The employee and the Human Resources
Director may call witnesses to testify at a grievance hearing. Falsifying a statement is FRQVLGHUHGDV³VHULRXVPLVFRQGXFW´DQGPD\UHVXOWLQWKHHPSOR\HH¶VVXVSHQVLRQRUVHSDUDWLRQ
Attachment number 2
Page 63 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 64 | P a g e
Formatted: Centered
from employment;
(h) Each party may conduct such cross examination as shall be required for a full and true
disclosure of the facts. In addition, the Personnel Board members may examine the witnesses;
(i) Before closing the hearing, the Chairperson may allow both parties the opportunity to make
brief oral or written closing statements. The employee may present his or her closing
statement first;
(j) At any point during the hearing, of his/her own accord or at the request of either party, the
Chairperson may grant a fifteen (15) minute recess to allow the parties engage in confidential
settlement negotiations. This initial fifteen (15) minute recess may be extended by the
Chairperson if both parties signify that progress is being made in the settlement negotiations.
(k) Within ten (10) working days of the hearing, a final decision will be rendered by the Personnel
Board. Should the Board fail to overrule the dismissal decision, the dismissal shall stand. If WKHGLVPLVVDOGHFLVLRQLVUHYHUVHGE\WKH3HUVRQQHO%RDUGDQGWKH3HUVRQQHO%RDUG¶VGHFLVLRQ
is upheld in the review and appeal process (or no timely appeal is filed), the employee shall be
³PDGHZKROH´E\EHLQJUHLQVWDWHGDVDQHPSOR\HHDQGSURYLGHGEDFNSD\
(l) The Human Resources Director will notify the employee in writing of the final decision of the
Personnel Board and will be responsible for implementation of any action ordered by the
Board.
(5) Time Limitations. In the hearing of an appeal, the parties are subjected to the following time
limitations in the presentation of their cases and such time will be monitored by the clerk of the
Personnel Board.
(a) Opening Statements. Each party shall have a maximum of five (5) minutes to make an
opening statement.
(b) Presentation of Evidence. Each party shall have an initial time period of thirty (30) minutes to
present evidence in support of their case. A party may be granted one or more extensions of
time in fifteen (15) minute increments, upon motion and good cause shown, to complete
presentation of evidence in support of their case.
(c) Closing Statements. Each party shall have a maximum of five (5) minutes to make a closing
statement.
' 5HYLHZRIWKH3HUVRQQHO%RDUG¶V'HFLVLRQA decision of the Personnel Board shall not limit the
rights of either party to further review and such decision shall be stayed by the filing of a petition for
review. Any party, including the Human Resources Director, who has exhausted all administrative
remedies available before the Personnel Board and who is aggrieved by a final ruling or order of the
Personnel Board on any hearing may seek further review of the decision or order of the Personnel Board
in accordance with the Augusta, Georgia Personnel Policies and Procedures Manual.
(1) ,QWKHDEVHQFHRIDQDSSURSULDWHDFWLRQIRUUHYLHZRIWKH3HUVRQQHO%RDUG¶Vdecision, within such WLPH IRU UHYLHZ WKH 3HUVRQQHO %RDUG¶V GHFLVLRQ VKDOO ZLWKRXW IXUWKHU SURFHHGLQJV RU QRWLFH
become the final decision of the Personnel Board and any right of additional appeals shall be
extinguished.
(2) 5HFRUGIRU5HYLHZRI%RDUG¶V'HFision. Upon receipt by the Chairperson of the Personnel Board RIDQDSSURSULDWHDFWLRQIRUUHYLHZRIWKH3HUVRQQHO%RDUG¶V'HFLVLRQWKH%RDUG&OHUNDQGRU
Attachment number 2
Page 64 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 65 | P a g e
Formatted: Centered
Human Resources Department representative shall transmit a certified copy of the entire record to
the reviewing body.
(3) The Chairperson of the Personnel Board Shall Answer any Writ of Certiorari to the Superior Court
of Richmond County.
Section 300.016 Appeals from the Personnel Board to the Administrator: Terminations Only
1. Should an employee or the HR Director disagree with the Personnel Board¶VGHFLVLRQeither
may file an appeal to the Administrator, whose decision shall be the final administrative step
in the appeals process. The employee and the HR Director shall have five (5) business days
from notification of the decision of the Personnel Board being sent by the HR Department to
the employee, to file a written appeal to the Administrator. The written appeal shall contain a
short descriptive statement containing the reasons the appealing party believes the Personnel %RDUG¶VGHFLVLRQVKRXOGEHRYHUUXOHG
2. Within ten (10) working days of a timely filed request for appeal to the Administrator, the
Human Resources Department shall deliver a complete transcript of the Personnel Board
hearing and all documents and items admitted as evidence by the Personnel Board in
accordance with the Personnel Board bylaws.
3. The Administrator shall review the Personnel Board Record and render a written decision and
within ten (10) working days of the delivery of the Personnel Board record. The
Administrator may uphold, overturn, or modify the decision of the Personnel Board at his or
KHUGLVFUHWLRQ7KH$GPLQLVWUDWRU¶VGHFLVLRQVKDOOFRQWDLQDGHVFULSWLYHVWDWHPHQWGHVFULELQJ
the reasons the Administrator rendered the decision he or she made.
Section 300.017 Appeals from the Administrators Final Decision to Superior Court
1. Should an employee or the Augusta, Georgia Commission disagree with the $GPLQLVWUDWRU¶V
decision, either may file an appeal to Richmond County Superior Court in accordance with the
laws of the State of Georgia.
2. In the event that an appeal to Superior Court is filed, it shall be the responsibility of the HR
Director to ensure that a certified copy of the complete record is submitted to Superior Court in
accordance with Georgia law and the Personnel Board Bylaws.
Attachment number 2
Page 65 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 66 | P a g e
Formatted: Centered
Notice of Letter of Warning
(Form HR-ER I)
Employee________________________ Job Title_______________________________
Date Hire_________________________
Supervisor___________________________ Job Title_______________________________
Department__________________________ Date of Incident______________________
I. Explanation
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
II. The following corrective action is expected of the employee:
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
I. Future infraction(s) may result in:
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
Signatures
_____________________________________________
Employee Date
_____________________________________________
Supervisor Date
Attachment number 2
Page 66 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 67 | P a g e
Formatted: Centered
Notice of Disciplinary Action Form
(Form HR-ER II)
Written Reprimand
Employee________________________ Job Title_______________________________
Date Hire_________________________
Supervisor___________________________ Job Title_______________________________
Department__________________________ Date of Incident______________________
II. Disciplinary action is being taken for the following reason(s) (include dates(s) of infraction
and violation of stated policy):
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
III. Explanation (include dates and explanation of previous relevant discussions and/or
discipline):
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
IV. The following corrective action is expected of the employee:
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
V. Future infraction(s) may result in:
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
Attachment number 2
Page 67 of 269
Item # 11
Attachment number 2
Page 68 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 69 | P a g e
Formatted: Centered
Notice of Disciplinary Action
(Form HR-ER III)
(Suspension/Demotion)
Current Date:
Employees Name:
Street Address
City, State, Zip Code
RE: Notice of Proposed Disciplinary Action ± Decision to Suspend Without Pay:
Dear Mr./Mrs./Ms: (Employees last Name)
This letter is to inform you that effective (date and time) you have been placed on suspension for ( )
days. This is due to your violation of Augusta, Georgia Policies.
State violations:
Please be advised that in accordance with the Augusta, Georgia Grievance and Appeal Procedures,
you have the right to file an appeal. Your request for an appeal must be submitted to the Director
of Human Resources in writing within five (5) working days, of receipt of this letter.
If you have, any additional, questions or concerns related to this information do not hesitate to contact me
or the Director of Human Resources at 706-821-2303.
Sincerely,
Name_____________________________________________________
Receipt acknowledged: __________________________ Date:__________
Attachment number 2
Page 69 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 70 | P a g e
Formatted: Centered
Notice of Disciplinary Action
(Form HR-HER IV)
Recommendation for Termination
Current Date:
Employees Name:
Street Address
City, State, Zip Code
RE: Notice of Proposed Disciplinary Action ± Termination:
Dear Mr./Mrs./Ms: (Employees last Name)
This letter is to inform you that effective (date and time) you have been recommended for termination.
This is due to your violation of Augusta, Georgia Policies.
State violations:
If you disagree with this recommendation you may request that the HR Director conduct an administrative
review of this request where you will be provided the opportunity to explain why you believe you should
not be terminated. To request an administrative review of this recommendation, you must submit a
written request to the Director of Human Resources within five (5) days of receipt of this letter. Your
request for an administrative review should be forwarded to the attention of the Director of Human
Resources, 530 Greene Street, Room 601, Augusta, Georgia 30901.
Should you not agree with the +5'LUHFWRU¶VGHFLVLRQIROORZLQJ the administrative review, you have the
right to appeal to the Augusta, Georgia Personnel Board within five (5) days of receipt of the written
notification of the HR Director¶VGHFLVLRQ
If you have, any additional, questions or concerns related to this information do not hesitate to contact me
or the Director of Human Resources at 706-821-2303.
Sincerely,
Name: ________________________________________________________
Receipt acknowledged: __________________________ Date: __________
Attachment number 2
Page 70 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 71 | P a g e
Formatted: Centered
Request for Admin Review or Appeal
(Form HR-ER V)
Any regular employee in the Classified Service recommended for a written reprimand,
performance improvement plan, suspension without pay, demotion, or termination has a right to
Administrative Review by the Director of Human Resources or the Administrator (depending on
the level of discipline). This request must be submitted to the Director of Human Resources in
writing within five (5) working days of receiving notice of the recommended action.
Employee Name_________________________ Employee ID #________________________
Employee Title______________________ Date of Hire_______________
Department No.__________________ Department Name: ____________________
Department Head___________________________ Supervisor_______________________
Date of Incident _________ Nature of Incident_________________________________
I am appealing the following disciplinary action (SODFHDQ³;´LQWKHDSSURSULDWHER[):
Suspension without Pay ( ) Demotion ( ) Termination ( )
REASONS FOR THE ADMINISTRATIVE REVIEW
INSTRUCTIONS:
Please state exactly what happened to cause the disciplinary action, when it happened, who was
involved and what policy, law, or contract clause you allegedly violated, and reason(s) you believe
that the action taken against you by management was not justified (print or type): Note: You may
attach additional documents or continue your written request on additional pages, but you must
number and sign/date each additional page.
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
_____________________________________________________________________________________
Employee Signature: _______________________________Date_______________________
Received by (Human Resources Department):
______________________________________________________________________________
Human Resources Signature:______________________________Date_____________________
Attachment number 2
Page 71 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 72 | P a g e
Formatted: Centered
Was request filed within five (5) workdays of receipt of the disciplinary action?
Yes_____
No_____
,I WKH HPSOR\HH¶V DGPLQistrative review request was not received by the Human Resources Director
within five (5) working days of receipt of the disciplinary action, it is untimely and will not be processed.
In this event, please sign below, copy and return the original of the appeal to the employee:
______________________________________________________________________________
Human Resources Department Date
Original to employee
Departmental file
Human Resources employee file
Attachment number 2
Page 72 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 73 | P a g e
Formatted: Centered
(NOTICE OF FINAL DECISIONS)
(Form HR-ER VI)
VIA CERTIFIED MAIL/RECEIPT REQUESTED
Current Date:
Employees Name:
Street Address
City, State, Zip Code
RE: Final Decision:
Dear Mr./Mrs./Ms: (Employees last Name)
An administrative review was conducted on ____(Date)___________for violation of Augusta, Georgia
Policies and Procedures:
State violations as stated:
After considering all of the facts, I am in agreement with the 'HSDUWPHQW'LUHFWRU¶VUHFRPPHQGDWLRQ
regarding the (Demotion, suspension, Termination) etc.
In accordance with the policies and procedures of Augusta, Georgia this decision may be appealed in
accordance with the procedures provided in the Employee Handbook.
[Reference the sections in the handbook relevant to the type of decision rendered.]
Sincerely,
[Name], Human Resources Director
cc: [Name], Administrator
[Name], General Counsel
[Department Director, Title]
Attachment number 2
Page 73 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 74 | P a g e
Formatted: Centered
Table I Recommended Guidelines For Disciplinary Actions
LEGEND:
L = Letter of Warning S = Suspension
W = Written Reprimand T = Termination
Infraction
Category
First
Offense
Second
Offense
Third
Offense
Fourth
Offense
Disregard for or willful failure to
follow the written instruction or
direction of a supervisor or higher
authority
Insubordination W S/T T
Abusive verbal conduct directed at a
VXSHUYLVRUZLWKLQWKHHPSOR\HH¶V
chain-of-command.
Insubordination W/S S/T T
Failure to work overtime, special
hours, or special shifts or be on stand-
by, as directed
Insubordination W-S S/T T
Violation of any Augusta, Georgia,
department or division rule or
directive
Neglect of Duty L W S T
Inability to perform up to accepted
work standards
Neglect of Duty L W S T
Habitual tardiness, unscheduled
absence (six (6) or more in a 180 day
period), absenteeism, and/or abuse
of leave privileges
Neglect of Duty L W S T
Willful neglect in performance of
duties
Neglect of Duty W/S S/T T
Job abandonment for 3 consecutive
scheduled workdays, or 2 consecutive
24-hour shifts.
Neglect of Duty S/T T
Leaving the assigned work area
during regular working hours without
permission or until relieved.
Neglect of Duty L W S T
Absence without approved leave,
including failure to call in or report an
absence to a supervisor the day the
absence begins.
Neglect of Duty W S T
Attachment number 2
Page 74 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 75 | P a g e
Formatted: Centered
Infraction
Category
First
Offense
Second
Offense
Third
Offense
Fourth
Offense
%HLQJLGHQWLILHGDV³DWIDXOW´LQDQ
accident or collision by the Safety
Review Committee while the operator
of Augusta, Georgia vehicle or piece
of equipment.
Neglect of Duty See SRC
Penalty
Matrix
See SRC
Penalty
Matrix
See SRC
Penalty
Matrix
Failure to maintain licenses,
certifications and/or other
professional credentials required for
employment or failure to notify
appropriate Augusta, Georgia
officials of their loss, suspension, or
revocation.
Neglect of Duty S/T T
Suspension or revocation of Driver
License or Commercial Driver
License (CDL) if it is required for the
performance of job duties.
Neglect of Duty W/S/T S/T T
Willful or negligent violation of a
safety policy, which results in
property/equipment damage or
personal injury.
Neglect of Duty W/S/T S/T T
Violating a safety rule or practice or
any conduct which could endanger a
co-worker or member of the public.
Neglect of Duty W/S/T S/T T
Operating, or directing the operation,
of an Augusta, Georgia vehicle or
equipment without proper
qualifications or supervision.
Neglect of Duty W S T
Failure to immediately report any on-
the-job accident to a supervisor or
member of the chain-of-command.
Neglect of Duty W S T
Failure to report to the Department a
subpoena or request for information
from a law firm that relates to
Augusta, Georgia business.
Neglect of Duty L W S T
Possession or sale of alcohol or illicit
drugs on Augusta, Georgia property
(including vehicles).
Neglect of Duty T
Working under the influence of
alcohol or illicit drugs.
Neglect of Duty T
Attachment number 2
Page 75 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 76 | P a g e
Formatted: Centered
Infraction
Category
First
Offense
Second
Offense
Third
Offense
Fourth
Offense
Violation of traffic laws while
operating Augusta, Georgia vehicle,
i.e. speeding, running traffic control
device, failure to yield, etc.
Neglect of Duty L W S T
Motor Vehicle Record review with 10
points or more ± impact on driving
privileges
Neglect of Duty T
Fraud, waste, and/or abuse of
Augusta, Georgia property or time.
Ethics Violation W/S/T S/T T
Falsification or misrepresentation of
an official document or record.
Ethics Violation W/S/T S/T T
Falsification or misrepresentation of
any portion of a job application.
Ethics Violation W/S/T S/T T
Violation of Augusta, Georgia
policies relating to impartiality, use of
public property, conflict of interest,
disclosure or confidentiality.
Ethics Violation W S T
Conviction of a felony, a
misdemeanor conviction involving
moral turpitude, or any misdemeanor
while in the performance of Augusta,
Georgia duties.
Ethics Violation S/T T
Unauthorized possession of firearms,
explosives, or weapons on Augusta
property.
Ethics Violation W/S/T S/T T
Unauthorized vending or solicitation
on property or from Augusta, Georgia
vehicle.
Ethics Violation L W S T
Attempting to coerce or influence a
member of the public, fellow
employees, subordinates or supervisor
with gifts, services, loans or other
consideration OR receipt of a fee, gift,
or valuable item when such is given
or accepted in the expectation of
receiving a favor or preferential
treatment.
Ethics Violation S T
Attachment number 2
Page 76 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 77 | P a g e
Formatted: Centered
Infraction
Category
First
Offense
Second
Offense
Third
Offense
Fourth
Offense
Directing or permitting a subordinate
to violate any rule, policy or
regulation, whether explicit or
condoned through inaction.
Ethics Violation W/S S/T T
Engaging in any employment, activity
or enterprise which is illegal,
incompatible, or in technical conflict ZLWKWKHHPSOR\HH¶VGXWLHVDQG
responsibilities as Augusta, Georgia
employee.
Ethics Violation S/T T
Engaged in outside employment
activity while using sick leave,
ZRUNHU¶VFRPSHQVDWLRQOHDYHRU
catastrophic leave.
Ethics Violation T
Intentional destruction, theft or
unauthorized removal of Augusta,
Georgia property or assets for
personal use.
Ethics Violation W/S/T S/T T
Intentional destruction, theft
(including stealing time) or
unauthorized removal, possession or
use of Augusta, Georgia property,
tools or equipment without consent.
Ethics Violation W/S/T S/T T
9LRODWLRQRI$XJXVWD*HRUJLD¶V
discrimination and/or unlawful
harassment policies.
Ethics Violation W/S/T S/T T
Gross misconduct to include, but not
limited to, physical violence, threats
of physical violence or engaging in
offensive conduct or language toward
the public, supervisory personnel, or
fellow employees.
Ethics Violation S/T
Membership in any organization that
advocates the overthrow of the
Government of the United States by
force or violence.
Ethics Violation T
Misconduct which undermines
supervisory authority, productivity, or
morale.
Ethics Violation W S T
Attachment number 2
Page 77 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 78 | P a g e
Formatted: Centered
Infraction
Category
First
Offense
Second
Offense
Third
Offense
Fourth
Offense
Off duty conduct (e.g. conviction of a
felony) which reflects very
unfavorably upon the image and
ethical standards of Augusta, Georgia
as an employer.
Ethics Violation W/S/T S/T T
Violation of Augusta, Georgia
Internet Use Policies (e.g. social
media, pornographic sites, etc.)
Work Ethics
Violation
W S T
Violation of Augusta, Georgia Email
Policies (e.g. Passing on inappropriate
chain emails and non-work related
content, etc.) and/or excessive
personal email/web time.
Work Ethics
Violation
W S T
Unauthorized use of Augusta,
Georgia vehicles or equipment on or
off-duty.
Work Ethics
Violation
W S T
Attachment number 2
Page 78 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 79 | P a g e
Formatted: Centered
CHAPTER IV.
CAREER LADDERS, LATTICES, AND JOB TITLING POLICY
Introduction
Career ladders and lattices consist of related jobs that comprise a career. They often include a
representation of job progression in a career as well as detailed description of the jobs and the experiences
that facilitate movement between jobs. Career ladders display only vertical movement between jobs. The
Classification & Compensation Administration and Management unit shall utilize the approved U.S. 'HSDUWPHQWRI/DERU¶V&RPSHWHQF\0RGHO³Clearinghouse´ tool as a guide for the development of Career
Ladders for the entire organization. The tool is designed to be used in conjunction with the Building
Blocks for Competency Models. When utilized, it will help Augusta, Georgia employees visualize and
learn about the job options that are available as they progress through a career.
Career ladders and lattices shall be in line with our job titling system or policy. For example - a new job
titling system shall group non-represented jobs into related and logical progressions. Jobs shall be
organized by field, which is a broad occupational grouping. (Information Technology for example, would
be a job field). Within each field is a group of job families, which are more specific, such as the Database
Administration family. Within each family are categories of jobs, which describe the nature of work
performed, such as Professional or Supervisory & Managerial.
Lastly, within each category there are different levels of jobs. For example, for professionals within the
Database Administration family, there is a Database Administrator I, II, III, IV and V. Not all families
have every category or level ± only those that are required to represent current jobs.
Also, the intent is that all employees who perform the same type of work at the same level of expertise
will be assigned the same organization-wide job code, pay grade, FLSA classification, job description
(with same educational requirements, work-related experience requirements including, but not limited to,
formal training, on the job training, years of experience, licensure requirements, and skills to develop or
tasks to perform that will prepare an individual for a new position.
Augusta, Georgia¶V&DUHHU/DGGHULVDSODQQHGSURJUHVVLRQWRDQHZMREDQGSURYLGHVDQRWKHUZD\IRU
employees to advance in their Augusta, Georgia careers. Since the employee and the manager negotiate
the advancement to the next higher level position, there does not have to be a position vacancy. Career
Ladder progression is a two-fold process. The department must need the higher level position, and the
employee must be both interested in the higher level job as well as demonstrate the potential to attain the
skills needed to perform it successfully.
Section 400.001 - Who is Eligible?
You are eligible if you are a regular full or part-time employee who is not on probation. The overall rating
on your most recent performance review must reflect overall performance that "Meets Expectations" or
better. During a Career Ladder, you must maintain your performance at this level. If your job is classified
as a manager or higher, you are not eligible for a Career Ladder. All other job titles, however, are eligible
for either a pre-approved or individual Career Ladder.
Attachment number 2
Page 79 of 269
Item # 11
Attachment number 2
Page 80 of 269
Item # 11
Attachment number 2
Page 81 of 269
Item # 11
Attachment number 2
Page 82 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 83 | P a g e
Formatted: Centered
*Note to Managers
As a position within your department becomes vacant, you are encouraged to evaluate the current level of
classification for the vacancy. You may consider using the opportunity of the vacancy to revert the
vacancy classification back to its original level, in order to provide growth planning for a new employee
filling this vacancy, and to generate additional funding to the department, perhaps for meeting new Career
Ladder plan.
Section 400.010 ± Compensation for Degrees, Licenses, and Certifications
(All degrees, licenses, certifications, etc., eligibility must be approved by the Department
Director and the HR Director prior to the employee beginning the degree, licenses,
certifications, etc., for any reimbursement to be authorized for payment. Authorization for
payment is subject to funds availability.)
A. Degrees -
Incentives for degrees IURP$XJXVWD*HRUJLD¶VDSSURYHGDFFUHGLWHGLQVWLWXWLRQVRIKLJKHU
learning are as follows -
1. Associate Degree - $1,500
2. %DFKHORU¶V'HJUHH - $3,000
3. 0DVWHU¶VDegree - $4,500
4. Doctorate Degree - $6,000
Degrees must be related to an employee specific job description/duty, and must be DSSURYHGE\WKHHPSOR\HH¶V6XSHUYLVRU$VVLVWDQW'LUHFWRU V DQG'HSDUWPHQW'LUHFWRU
Degrees will have to be earned during employment with Augusta, Georgia on or after
January 1, 2011. 6SHFLDODQGRUUDUHVLWXDWLRQV ZLOOEHGHWHUPLQHGE\WKHHPSOR\HH¶V
Department Director with approval of the HR Director. Employees will receive fifty
(50%) percent of the incentive upon completion of the degree and fifty (50%) percent of
the incentive on the one year anniversary of the completion of the degree so long as the
employee remains employed by Augusta, Georgia.
LIMITATION - Not more than $6,000 is to be paid to an employee within a three (3) year
period for earning degrees.
B. Licenses -
One-time payments for each professional license will be $2,000. Licenses must be directly
related to an employee¶V specific job description/duty, and must be approved by the
HPSOR\HH¶V6XSHUYLVRU$VVLVWDQW'Lrector(s), Department Director, and the HR Director.
Prior professional licenses before employment with Augusta, Georgia will not be
acceptable for the one-time payment. License must be obtained while employed with
Augusta, Georgia.
LIMITATION - Not more than $4,000 is to be paid to an employee within a two (2) year
period for obtaining licenses.
Attachment number 2
Page 83 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 84 | P a g e
Formatted: Centered
C. Master or Special Certificate in applicable professions -
One-time payments for each Master or Special Certificates will be $2,000. Master or
Special Certificate (Professional) must be directly related to an employee specific job
GHVFULSWLRQGXW\DQGPXVWEHDSSURYHGE\WKHHPSOR\HH¶V6XSHUYLVRU$VVLVWDQW'LUHFWor,
and Department Director and the HR Director. Prior professional Master or Special
Certificates before employment with Augusta, Georgia will not be acceptable for a
payment. Master or Special Certificates must be obtained while employed with Augusta,
Georgia.
LIMITATION - Not more than $4,000 is to be paid to an employee within a two (2) year
period for obtaining Master or Special Certificates.
D. Professional Designation Certifications -
One-time payments for each Professional Designation Certifications will be $2,000 added WRWKHHPSOR\HH¶VFXUUHQWVDODU\&HUWLILFDWLRQVPXVWEHGLUHFWO\UHODWHGWRDQHPSOR\HH¶V
VSHFLILF MRE GHVFULSWLRQGXW\ DQG PXVW EH DSSURYHG E\ WKHHPSOR\HH¶V 6XSHrvisor,
Assistant Director(s), Department Director and the HR Director. Prior Professional
Designation Certifications before January 1, 2011 with Augusta, Georgia will not be
acceptable for a pay increase. Certifications are considered proof of a level of knowledge
to pass the certification test prior to being allowed to take any certification examination.
For this reason, the Augusta, Georgia will pay for fee and travel expenses to cover one DWWHPSW DW HDFK FHUWLILFDWLRQ $OO VXEVHTXHQW DWWHPSWVZLOO EH DW WKH HPSOR\HH¶V RZn
expense. Applied aspect of knowledge demonstrated through a certification is critical. It is
expected that the certification will enhance an employee work efficiency and technical
know-how. Therefore, the employee has to demonstrate improvement in his or her work
productivity and work quality.
LIMITATION - Not more than $4,000 is to be paid to an employee within a two (2) year
period for obtaining Professional Designation Certifications.
Attachment number 2
Page 84 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 85 | P a g e
Formatted: Centered
Attachment number 2
Page 85 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 86 | P a g e
Formatted: Centered
INDIVIDUAL CAREER LADDER FORM
Current
Job Title
Proposed
Job Title
Form 2A - To be Completed by Employee and Manager when entering a Career Ladder
Submit Original to Human Resources-Compensation for Approval
Employee Name
-
Department
Name - Department Code -
Current Job
Title/Grade - Current Pay Rate -
Length of Time in
Current Title - Estimated Date of
Completion -
Does Employee meet all Requirements of
Current Job? (Yes/No) Estimated Pay Rate after
Completion -
(Please refer to Job Descriptions for complete information on position)
Job Titl
Job Coe
Grade
Job Tile
Job Code G ad
e
Additional Requirements for this
Position
Action Plan
(How employee will meet
additional requirements)
Proposed
Completion
Date
Performance -
Min. Education -
Min. Experience -
Licenses/Certifications -
AUGUSTA, GEORGIA Required
Training -
Knowledge, skills and abilities, as
stated in the job description for this
position, have been attained.
If more space is required, or if more
distinguishing characteristics exist, please
attach additional sheets.
Employee's performance must
"meet expectations" or better.
throughout this career ladder
progression.
Knowledge, skills and abilities
as stated in the job description
for this position must be
achieved by the completion of
this progression.
Distinguishing Characteristics -
a.
Attachment number 2
Page 86 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 87 | P a g e
Formatted: Centered
Form 2A - Continued
b.
c.
d.
e.
f.
Other - (Department Specific)
REVIEW/APPROVALS
_______________________________________________________ ______________________
Employee (Print Name) Date
_______________________________________________________ ______________________
Department Director Date
_______________________________________________________ ______________________
Compensation Administration Staff Date
_______________________________________________________ ______________________
HR Director Date
Attachment number 2
Page 87 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 88 | P a g e
Formatted: Centered
0$1$*(5¶6(/,*,%,/,7<&+(&./,67 (Form 1A)
(Pre-Approved or Individual Career Ladder)
Please review prior to establishing progression to ensure eligibility of position/employee.
If you are unsure of eligibility, please contact Human Resources-Compensation before forming progression with
employee.
Employee Name
-
Department
Name - Department Code -
Current Job
Title/Grade - Current Pay Rate -
Length of Time in
Current Title - Estimated Date of
Completion -
Does Employee meet all Requirements of
Current Job? (Yes/No) Estimated Pay Rate after
Completion -
(Please refer to Job Descriptions for complete information on position) Please answer Yes or No to the questions below.
1. Is employee past the AUGUSTA, GEORGIA probationary period? Yes No
2. Is employee free of current written warning/disciplinary action, and does the last annual performance review
show an overall rating of "Meets Expectations" or higher? Yes No
3. Does department have funding for proposed increase upon completion of progression? Yes No
4. Does the department structure allow for this position? Yes No
(Ex - There is already one supervisor in the department, and structure does not allow for two)
5. Can the department support the new level of duties required of this position? Yes No
(Ex. - Are these additional duties required by the department, or are the duties being moved from another
incumbent to this one? If the duties are being moved, is the RWKHULQFXPEHQW¶VSRVLWLRQMHRSDUGL]HG"
6. Has this department been free of layoffs in similar classifications for the past 12 months? Yes No
7. Is this either the 1st or 2nd Career Ladder progression for this employee at AUGUSTA, GEORGIA? Yes No
+DVDWOHDVWPRQWKVHODSVHGVLQFHHPSOR\HH¶VODVWFDUHHUODGGHUSURJUHVVLRQ"<HV No
,IDOOTXHVWLRQVKDYHEHHQDQVZHUHG³<HV´SOHDVHSURFHHGZLWK)RUP$IRU,QGLYLGXDO&DUHHU/DGGHUZLWK\RXU
employee.
Please attach a current department organization chart with this form. ,IDQ\DQVZHULV³1R´HPSOR\HHDQGRUSRVLWLRQ
is not eligible at this time. Please pursue alternative Career Development programs.
REVIEW/APPROVALS
_______________________________________________________ ______________________
Employee (Print Name) Date
Department Director Date
_______________________________________________________ ______________________
Compensation Administration Staff Date
_______________________________________________________ ______________________
HR Director Date
Attachment number 2
Page 88 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 89 | P a g e
Formatted: Centered
CHAPTER V.
COMPENSATION
A. GENERAL
Authority of the Administrator ± The Administrator shall have the authority to approve all
classifications, reclassifications, reorganizations, pay adjustments up to fifteen percent (15%) of base pay
and final decision authority of classification appeals.
Section 500.001 Compensation Philosophy
Augusta, Georgia is committed to a results-oriented government that provides efficient and accountable
government services.
Our goal is to attract, retain and motivate committed, hard-working, creative and thoughtful employees
who support our mission to meet and exceed the expectations of our community, not only in service
delivery but in building a better place for all of us to live and work. The main focus of the compensation
philosophy is to increase productivity, maximize efficiency and improve overall service level for Augusta,
Georgia citizens. For our employees, that means we are committed to:
¾ Providing opportunities for our employees to grow and develop their skills, knowledge, and
their careers.
¾ Ensuring individual accountability for performance and results.
¾ Communicating openly with our employees about our organization/mission, our successes and
our failures, and opportunities for us to do things better.
¾ Providing a competitive total compensation package.
The total compensation program at Augusta, Georgia is designed to assist us in creating and supporting a
high-performance, responsive and competitive organization. The total compensation program is made up
of salary/wages and benefits.
In order to accomplish these goals and to ensure that the compensation program is consistent with its
direction, stated mission, and goals, Augusta, Georgia government commits to the pay philosophy
statements as follows:
Augusta, Georgia¶VWRWDOFRPSHQVDWLRQSKLORVRSK\LVWRSURYLGHSD\DQGEHQHILWVVXIILFLHQWWRDWWUDFWDQG
retain the qualified and skilled employees to accomplish Augusta, Georgia¶VVWUDWHJLFSODQ:
1. Position total compensation (pay and benefits) to be aimed at midpoint of the market;
2. There are conditions where exceptions may be necessary, in situations such as -
¾ Recruiting the desired level of talent in certain jobs is a sustained problem and results in
negative impacts to the organization;
¾ Retention issues, including succession and turnover;
¾ Significant changes in the economy or marketplace; and
¾ Internal anomalies in alignment, disparities or inconsistencies.
Attachment number 2
Page 89 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 90 | P a g e
Formatted: Centered
Pay programs are intended to be competitive at a minimum with the average pay of benchmark
organizations in the primary labor market. The primary labor market is currently defined as those counties
or city governments that are of comparable size in terms of revenue, number of full time employees, etc.
in the southern part of the U.S where Augusta, Georgia competes for talent acquisition. A list of such
comparable organizations in the labor market shall be maintained in Human Resources.
a. As deemed necessary, the Human Resources Director may recommend that other comparators
should be used where information from the primary labor market is considered insufficient to
attract and retain specific positions or classes.
b. Augusta, Georgia shall adopt a pay for performance policy. The pay for performance policy is
designed to recognize job performance and requires annual approval by Augusta, Georgia¶V%RDUG
of Commissioners. The decision to provide employees a performance increase is contingent upon
an overall performance appraisal rating and availability of funds.
c. Nothing in this compensation philosophy statement should be construed as a required benefit in
the event that Augusta, Georgia experiences a decline in revenue or a revenue growth lower than
the projected increase in expenses.
d. As part of Augusta, Georgia¶V&RPSHQVDWLRQVWUDWHJ\WKHVDODULHVRIUHSUHVHQWDWLYHEHQFKPDUN
classes for all occupational groups shall be compared to the minimum and maximum salaries, with
a focus on the mid-point, of the benchmark jurisdictions.
e. The benchmark matches are also reviewed and validated annually by the participating
jurisdictions. This will allow the Compensation Administration team to capture on-going
evolutionary changes occurring within these occupations and provide a meaningful basis to make
market rate comparisons.
f. 7KHUHPDLQLQJMREFODVVLILFDWLRQVWKDWZHUHQRWVHOHFWHGDVDEHQFKPDUNMREVKDOOEH³OLQNHG´WR
one of the selected benchmark classes. This process will allow HR to affect both the benchmark FODVVDQGDQ\FODVVHV³OLQNHG´WRDEHQFKPDUNFODVVZKHQVXUYH\UHVXOWVLQGLFDWHDSD\DGMXVWPHQW
is necessary.
g. In determining the appropriate linkages, input will be obtained from Department Directors within
the organization. The list of benchmark classes and linked classes shall be reviewed and updated
as new classes are established or abolished in order to maintain accurate and timely data.
h. When determining Augusta, Georgia¶V PDUNHW FRPSHWLWLYHQHVV D PDUNet ratio (comp-a-ratio)
shall be utilized. Augusta, Georgia¶VUHODWLRQVKLSWRWKHPDUNHWLVVKRZQDVWKHPDUNHWUDWLRWKDW
falls below or rises above 100%. Job classes with a market ratio of less than 90% are considered to
be below the market. If an adjustment is authorized based upon the survey results, the grade for
the benchmark class(es) plus the linked class(es) would be adjusted to minimally place the
class(es) within the acceptable threshold of ninety to one hundred and ten percent (90-110%).
i. In all instances, for benchmark jobs, information for an assessment of pay competitiveness will be
ascertained through reliably current published compensation survey data.
Attachment number 2
Page 90 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 91 | P a g e
Formatted: Centered
j. Every two (2) years, the Human Resources Director will conduct a market study of benchmark
positions to determine the competitive posture of the organization, and propose a plan of action, if
needed, to bring any positions or classes into competitive alignment. At any time the Human
Resources Director determines that one or more particular classes need to be reviewed more
frequently than once every two (2) years, necessary action may be taken to assess the market SRVLWLRQ RI VXFK FODVVHV ZLWKRXW FRQVXOWLQJ WKH &RPPLVVLRQ 7KH $GPLQLVWUDWRU¶V DSSURYDO LV
UHTXLUHGWRFRQGXFWVXFKFODVVHV¶PDUNHWstudy.
B. COMPENSATION ADMINISTRATION
Section 500.101 Authority of the Administrator
The Administrator shall have the authority to approve all classifications, reclassifications, reorganizations,
pay adjustments up to fifteen percent (15%) of base pay and final decision authority of classification
appeals.
Section 500.102 Overview of Compensation Administration Program
The development and maintenance of $XJXVWD*HRUJLD¶V Compensation Policy is the responsibility of the
Human Resources Department. Each 'HSDUWPHQW¶V'LUHFWRUDQGWKH$GPLQLVWUDWRUDUHUHVSRQVLEOHIRUWKH
implementation of and adherence to all compensation program policies at each level of a department.
The compensation administration program is the formal system for classifying positions and
compensating employees of Augusta, Georgia. It is divided into two (2) distinct plans:
1. The compensation plan, which provides a salary structure, and the components of the
compensation plan. Each component will be discussed in detail in this Policy.
2. The classification plan, which is the categorization of job positions, duties and qualifications.
Section 500.103 The Compensation Plan
The Compensation Plan is designed as a fair and equitable method of payment to employees of the
organization. The Plan establishes a basic salary schedule, as recommended by the Administrator and
approved by the Augusta, Georgia Board of Commissioners. The salary structure includes the minimum,
midpoint and maximum rates of pay for all classes of positions included in the Classification Plan. In
addition to the basic salary schedule, the Compensation Plan consists of components, including, but not
limited to, market adjustments, pay for performance, and exceptional circumstance adjustments. The rate
of pay set forth in this Plan does not include allowance for actual travel expense authorized and incurred
as incidental to employment or overtime.
Section 500.104 Components of the Compensation Plan
The compensation for each employee is the product of the salary structure and the components of the
compensation plan that shall be used to adjust employee compensation. Each component of the
compensation plan is subject to funding approval on an annual basis by Augusta, Georgia Board of
Commissioners as part of the budget. These components are discussed in detail in the following sections.
Attachment number 2
Page 91 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 92 | P a g e
Formatted: Centered
Section 500.105 Market Adjustments
The market adjustment is the component that is used to ensure that the salary structures are adjusted to
reflect changes based on economic indicators. When applicable and when funds are available and
approved by Augusta, Georgia Board of Commissioners, an increase may be applied to the salaries of all
eligible employees, with the exception of those salaries set by state or local legislation. When an
employee's salary exceeds the maximum of the assigned pay grade, the employee's base salary will be
red-circled until the current salary falls within the assigned pay grade.
Section 500.106 Exceptional Circumstances Adjustments
When it is asserted, by a Department Director or Elected Official other than Commissioners, that an HPSOR\HH¶V VDODU\ UHTXLUHV DGMXVWPHQW WKH 'HSDUWPHQW'LUHFWRU RU (OHFWHG 2IILFLDO VKDOO SURYLGH
justificatioQWRDGMXVWHPSOR\HH¶VEDVHVDODU\GXHWRRQHRIWKHIROORZLQJVLWXDWLRQV:
1. Pay adjustments as determined by the HR Director to the Administrator.
2. Pay inconsistency as determined by the HR Director to the Administrator.
3. Employee retention purposes to the Administrator.
If approved, recruiting department is responsible for the budget if money is not in the budget, the
Department Director shall include item in the next fiscal year budget.
Exceptional circumstances adjustment requests, together with the required documentation, must be
submitted to the Human Resources Director. The Human Resources Director shall review a request for an
exceptional circumstances adjustment for compliance with this policy, before forwarding the request
along with his or her recommendation to the Administrator.
Section 500.107 Effective Date of Salary Adjustments
The effective date of any salary adjustment shall be determined by the Department Director or Elected
Official, in consultation with the Human Resources Director or designee and typically should be at the
beginning of a pay period. If funding is not available upon approval, the Department Director shall put the
approval amount into the budget for the following fiscal year budget.
Section 500.108 Starting Rates for New Employees
In most cases, a new employee shall be paid the minimum rate of the pay grade. Exceptions may be
approved by the Department Director/Elected Official, the Human Resources Director and/or the
Administrator, as set forth below. For all employees, approval authority is delegated to Department
Directors/Elected Officials for starting salaries that fall no more than ten percent (10%) of the minimum
pay on appropriate salary range. Starting salaries that fall more than ten percent (10%) but less than
fifteen percent (15%) of the established minimum annual salary shall require approval by the Human
Resources Director and the Administrator. Any salary offer that is over fifteen percent (15%) requires
Commission approval.
Attachment number 2
Page 92 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 93 | P a g e
Formatted: Centered
The following are examples of cases in which an exception might be approved as specified in the
above guidelines -
1. ,IDVHOHFWHGFDQGLGDWH¶VTXDOLILFDWLRQVH[FHHGWKHPLQLPXPTXDOLILFDWLRQVVWDWHGLQWKHMRE
posting and they will not accept appointment at the minimum rate of the class, the candidate
may be appointed at a higher rate. These cases should be thoroughly analyzed and measured
against objective qualification standards and reviewed and compared with the salaries of
current employees in the class by the Human Resources Compensation Administration unit.
2. Difficulty in recruitment may justify a higher rate. If difficulty in recruitment at the minimum
rate in the salary range persists, the HR Director and Administrator shall be consulted and
approval given first before assigning a higher hiring rate within the pay grade as long as the
salary offer is within ten percent (10%) of the minimum established salary range.
Appropriations for funding positions above the minimum rate must be secured within the
framework of the budget of the department employing the individual. Any recommendation
exceeding ten percent (10%) will be forwarded to the Administrator.
The Human Resources Director should be consulted by Department Directors prior to making any salary
offers or pay decisions. Department Directors and Supervisors will be held accountable if they create
internal inequity in their department.
If market conditions or unusual circumstances dictate a starting salary that is above ten percent (10%) of WKHMRE¶VPLQLPXPVDODU\UDQJH'HSDUWPHQW'LUHFWRUVVKDOOVXEPLWWRWKH+XPDQ5HVRXUFHV'LUHFWRUa
written request along with justification to that effect. The Administrator may approve or reject the request.
Such circumstances (e.g., tight labor market, education and/or experience levels which are significantly
above minimal job requirements) should be documented and verified by the Compensation
Administration unit.
Section 500.109 Employee Communication and Rights
Employees should receive written notification of any increase to their base pay. Supervisors should not
communicate any increase or promise to increase employee compensation unless they receive a written
notice from the Human Resources Director to do so. Employees who have issues or concerns with their
compensation (for other than EEO reasons) should follow the procedures in Section 500.316 herein.
Section 500.110 Annual Salary Schedule Determinations
The salary schedule should be reviewed on an annual basis in line with that of World at Work
(www.worldatwork.org) Compensation Organization, using the first (1st) QuartHURIWKH)LVFDO<HDU¶V&3,
Index (Bureau of Labor Statistics)(www.bls.gov/cpi/#tables), and/or comparable survey data. For
example, if World at Work Compensation Organization data indicates an average of three percent salary
structure adjustment, all Augusta, Georgia salary ranges should be adjusted by approximately three
percent (3%). Note - this is a salary schedule adjustment²not an individual salary adjustment. The HR
Director shall submit a recommendation by July 1 of each year, a CPI adjustment review and approve for QH[W\HDU¶VEXGJHWLQFOXVLRQ(PSOR\HHV¶DQQXDOLQFUHDVHVVKDOOEHLQGHSHQGHQWRIWKHVDODU\VFKHGXOH
adjustment.
Attachment number 2
Page 93 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 94 | P a g e
Formatted: Centered
Section 500.111 Annual Base Salary Adjustments
The maximum possible salary increase applicable to new employees (i.e., those hired during the current
fiscal year) shall be the same as that of other employees. All new employees must be on the roll in order
to be eligible for annual base salary adjustment.
Section 500.112 Part-time Continuing Employment
Part-time regular employees are assigned to appropriate classifications by the Human Resources Director.
The same principles which apply to starting rates of pay for full-time regular employees shall be used to
determine salaries of part-time employees. These employees shall be evaluated in accordance with the
Performance Appraisal System described in Human Resources Management Policies.
Section 500.113 Rehired Employees
Rehired employees include those individuals who were previously employed by Augusta, Georgia,
Richmond County or the City of Augusta and terminated their employment (former employee) or retired
(retiree) and are now seeking re-employment. Augusta, Georgia shall in all cases retain the sole discretion
for rehiring an individual and neither retirees nor former employees have any additional or special rights
by virtue of this policy.
Section 500.114 Former Employees
For the purposes of determining leave accrual, service awards, and any other program based upon length
of service as eligibility criteria, a re-hired employee who previously terminated their employment (for any
reason other than retirement) within one year of termination, shall receive prior service credit for their
previous full-time tenure with either Richmond County, the City of Augusta or Augusta, Georgia and
given an adjusted hire date to be calculated by the Human Resources Department.
Section 500.115 Retirees of Augusta, Georgia Statement of Policy
Augusta, Georgia recognizes the valuable service provided by long-tenured employees and provides a
retirement program for employees who have reached the end of their Augusta, Georgia career. As such, it
is $XJXVWD*HRUJLD¶V policy that employees who have achieved retirement status will not be reemployed
in a regular or full-time status. A retired employee may be hired back into a temporary part-time position
only. If the former employee has received a retirement incentive upon retirement, they are not eligible to
be rehired for twenty-four (24) months after their retirement date.
Section 500.116 Service Credit and Benefits
The retiree status will govern health plan participation and the rehired retiree will continue to receive only
those health benefits available to full-time retirees. Upon rehire, a retiree who desires Augusta, Georgia
health plan benefits must remain in the retiree plan and pay the prevailing retiree health plan contribution
rates. Rehired retirees will not earn additional Defined Benefit pension service credits by virtue of
reemployment tenure. Except for health plan participation and Defined Benefit pension credits, rehired
retirees will receive all benefits (compensated absences, etc.) as would other employees in a part-time
position.
Attachment number 2
Page 94 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 95 | P a g e
Formatted: Centered
Section 500.117 Employee Lateral Transfers
An employee may transfer to another department or office after six (6) months in current position and in
the same classification and such transfer shall not change the employee's pay rate or the date for
consideration for a pay for performance increase.
Section 500.118 Temporary Work at a Higher Classification/Provisional Employee
An employee may be required to work in a higher classification on a temporary, incidental, or emergency
basis and may do so for a period of thirty (30) days or less at no increase in pay. If the employee is
required to perform the duties for a period exceeding thirty (30) days, the employee shall be given a
temporary appointment to a higher position and be paid the appropriate rate for the higher classification.
At the conclusion of the appointment, the employee's pay shall revert to the authorized rate established for
the regular position. Any such temporary increase granted shall not affect the employee's eligibility for
normal pay for performance increases. Temporary appointments may not exceed six (6) months without
written approval for extension by the Human Resources Director and the Administrator. The Human
Resources Director and the Administrator, at the request of the department or office, may authorize one
(1) additional six (6) months extension. After the additional six (6) month extension, no further extension
shall be approved for the position unless approved by the Commission.
Section 500.119 Promotional Increase Policy
:KHQDQHPSOR\HHLQFOXGHGLQDVWUXFWXUHGSD\SODQLVSURPRWHGWKHHPSOR\HH¶VVDODU\ZLOOLQFUHDVHWR
up to ten percent (10%) above the minimum of the new grade or increase up to fifteen percent (15%)
DERYHWKHHPSOR\HH¶VFXUUHQWVDODU\ZKLFKHYHULVOHVV.
Section 500.120 Reclassification Promotions
If a reclassification results in an employee occupying a position of higher class and pay, the employee
shall be promoted to the higher class. In cases where promotion occurs as a result of a reclassification, the
employee's salary will increase at least to the minimum salary of the new pay grade. If an employee is
reclassified one (1) grade higher, the increase will be at least the minimum salary of the new pay grade or
up to five percent (5%) more than the previous salary. If the reclassification results in two (2) or three (3)
grade increases, the employee shall receive at least the minimum salary of the higher class or up to ten
percent (10%) more than the previous salary. If the reclassification is four (4) or more grades higher, the
employee shall receive at least the minimum salary of the new pay grade or up to fifteen percent (15%)
more than the previous salary. When an employee included in a structured pay plan is reclassified, the HPSOR\HH¶VVDODU\ZLOOLQFUHDVHDWOHDVWWRWKHminimum salary of the new grade.
Section 500.121 Procedures for Determining Promotional Increase
1. The Department Director or Elected Official will decide the amount of the promotional increase
within the standards stated in this policy. Promotional increases are not to exceed the maximum of
the range. If an employee is promoted and their salary is over the maximum of the range, the HPSOR\HH¶VVDODU\ZLOOUHPDLQUHG-circled until their salary falls back within the range. Employees
that do not receive a promotional increase because they are over the maximum of their new pay
grade shall receive the promotional increase as a lump sum, one-time payment only.
Attachment number 2
Page 95 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 96 | P a g e
Formatted: Centered
2. Final approval for all promotional increases must be made by the Human Resources Director. In
the event that a Department Director/Elected Official and the Human Resources Director do not
agree on a promotional increase, the Department Director/Elected Official may appeal the matter
to the Administrator for final disposition.
The decision regarding a promotional increase shall reflect the promoted employee's experience and
qualifications in comparison with other employees' backgrounds in the same job. If the Department
Director or Elected Official deems that the promotional guidelines as aforementioned do not fulfill this
requirement, the Director or Elected Official may request a promotional adjustment through the Human
Resources Director but not more than ten percent (10%) for the employee. Final approval must be made
by the Human Resources Director.
Section 500.122 Disciplinary or Involuntary Demotions
The Department Director or Elected Official shall furnish a written letter of intent to demote to the
employee detailing the reason(s) for the action, the pay adjustment and a notification of the right to appeal
as applicable.
The rate of pay for an employee that is demoted for disciplinary reasons shall be reduced up to ten percent
(10%) for up to three (3) grades demotion, or to the rate applicable to the new position as determined by
the Department Director or Elected Official and approved by the Human Resources Director. A demotion
of four (4) grades or more shall result in a reduction in salary up to fifteen percent (15%).
,QVLWXDWLRQVZKHUHWKHJXLGHOLQHVIRUUHGXFWLRQLQSD\GRQRWEULQJWKHHPSOR\HH¶VVDODU\ZLWKLQWKH grade
range for the position that the employee is demoted to, the salary shall be adjusted to the maximum pay of
the pay grade. Exceptions to this policy require written justification from the requesting department and
approval by the Human Resources Director.
Section 500.123 Reclassification Demotions
If a reclassification results in an employee occupying a position of lower class and pay, the employee
shall be demoted to the lower class. In cases where demotion occurs as a result of a reclassification, the
employee shall be allowed to continue at his or her current rate of pay, even though it exceeds the PD[LPXPRIWKHVDODU\UDQJHLQWKHORZHUFODVV+RZHYHUWKHHPSOR\HH¶VSD\UDWHVKDOOEH³UHGFLUFOHG´
thereby, disallowing any future salary increase until such time as - (1) the employee transfers into a job FODVVIRUZKLFKWKHPD[LPXPVDODU\LVKLJKHUWKDQWKHHPSOR\HH¶VFXUUHQWVDODU\RU WKHPD[LPXPVDODU\IRUWKHHPSOR\HH¶VFXUUHQWFODVVLQFUHDVHVWRDUDWHWKDWH[FHHGVWKHHPSOR\HH¶VVDODry.
Section 500.124 Voluntary Demotion
An employee may be demoted at their own written request to a vacant position in a lower class, subject to
the approval of the Department Director or Elected Official and the Human Resources Director. The
Department of Human Resources shall determine whether the employee meets the minimum
qualifications of the lower class of position.
When an employee is demoted to a minimum of five percent (5%) pay cut in the new position, the
employee shall be paid at a rate which is within the approved range for the lower position.
The rate of pay for an employee not included in a structured pay plan who is voluntarily demoted shall
have their rate of pay reduced up to ten percent (10%) for up to three (3) grades demotion, or to the rate
Attachment number 2
Page 96 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 97 | P a g e
Formatted: Centered
applicable to the new position as determined by the Department Director or Elected Official and approved
by the Human Resources Director. A demotion of four (4) grades or more shall result in a reduction in
salary up to fifteen percent (15%).
The rate of pay for an employee in a structured pay plan who voluntarily demotes shall have their rate of
pay reduced to the salary of the respective within the new grade. Employees who voluntarily demote
outside of a structured pay plan shall have their rate of pay reduced up to five percent (5%) for one (1)
grade and up to ten percent (10%) for a two (2) or three (3) grade demotion, or to the rate applicable to the
new position as determined by the Department Director or Elected Official and approved by the Human
Resources Director. A demotion of four (4) grades or more shall result in a reduction in salary up to
fifteen percent (15%).
,QVLWXDWLRQVZKHUHWKHJXLGHOLQHVIRUUHGXFWLRQLQSD\GRQRWEULQJWKHHPSOR\HH¶VVDODU\ZLWKLQWKHJUDGH
range for the position that the employee is demoted to, the salary shall be adjusted to the maximum pay of
the pay grade. Exceptions to this policy require written justification from the requesting department and
approval by the Human Resources Director.
Section 500.125 Involuntary Demotion Based on Conduct Violations
An involuntary demotion may also occur based on poor or unacceptable conduct. With this type of
demotion, a Performance Improvement plan is not necessary or required.
Section 500.126 Overtime Policy
All employees may be required to work overtime upon the request of the immediate supervisor,
Department Director or Elected Official. It is the policy of Augusta, Georgia to comply with the federal
Fair Labor Standards Act (FLSA) with regard to overtime policy for non-exempt employees.
Section 500.127 Overtime Policy for Full-time Non-exempt Employees
Upon authorization for overtime work, Supervisor shall clearly communicate to non-exempt employees
the method of compensation (compensatory time or overtime pay) prior to working the overtime.
Compensatory time shall be mutually agreed to by supervision and affected employee(s) prior to working
the overtime.
The base workweek or work cycle shall only include actual hours worked. Annual Leave, Sick Leave,
Workers' Compensation Time, holidays and other leave will not count toward the hours worked in the
work cycle for overtime purposes.
Section 500.128 FLSA Section 207(k) Public Safety Employees
Employees engaged in fire protection and law enforcement activities, including correctional officers, on
behalf of a public sector employer are subject to liberalized overtime standards under section (7)K of the
FLSA. Certain cross-trained emergency medical service personnel often qualify as well. Fire protection
employees are eligible for overtime based upon a declared work period which may range from not less
than seven (7) days nor more than twenty-eight (28) consecutive days and two hundred and twelve (212)
hours. The overtime standard ranges from 53 to 212 hours depending upon the length of the work period.
The work period rather than the shift cycle, determines when overtime must be paid. For law
Attachment number 2
Page 97 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 98 | P a g e
Formatted: Centered
enforcement personnel and correctional officers, the standard for a seven (7) to twenty-eight (28) day
work period ranges from forty-three (43) to one hundred and seventy-one (171) hours. The Human
Resources Department shall determine which protective service occupations may work under the work
cycle system. Non-exempt Public Safety employees, working on a work cycle will receive time and one-
half (1-1/2) for those hours that exceed the maximum for the work cycle. Each Department Director or
Elected Official shall determine the average scheduled number of hours worked in a year. The hourly rate
is calculated by dividing the annual base salary by the number of hours scheduled for the year.
Section 500.129 FLSA Section 213 (a) (3) Fully Exempt Seasonal/Recreational Employees
According to Section 213(a)(3) of the Fair Labor Standards Act, certain seasonal/recreational employees
are exempt from the overtime provisions of the law. This exemption applies to any employee who is
employed in a recreational establishment, organized camp, or non-profit educational conference center if:
a) the establishment does not operate for more than seven (7) months in any calendar year; OR b) during
the preceding calendar year, its receipts for any six (6) months of the year were not more than thirty-three
and one-third (33 1/3%) percent of its average receipts for the other six (6) months of the year. As a
matter of policy, persons employed by Augusta, Georgia, in a capacity falling within the above referenced
FLSA exemption shall be paid straight time for all hours worked.
Section 500.130 Overtime for Part-time, Non-exempt Employees
Part-time, non-exempt employees who work more than their normal work schedule but less than the
FLSA maximum hours for the appropriate work cycle will be paid at straight time. When hours worked
exceed FLSA maximums for the appropriate work cycle, part-time employees will be paid overtime at
time and one-half (1.5) of the regular rate.
Section 500.131 Compensatory Time Policy for Non-Exempt Staff
The Fair Labor Standards Act (FLSA) authorizes local governments to grant compensatory time (comp
time) off at a rate of one and half (1.5) hours for each overtime hour worked in lieu of cash overtime
compensation. However, comp time shall only be applicable to non-exempt employees.
Comp time accrued and used in the same FLSA work cycle is used as straight time (e.g. a non-exempt
employee works three (3) hours past his normal schedule on the third day of a seven (7) day FLSA work
cycle. The employee then uses the accrued comp time on the sixth day of the same FLSA work cycle. The
time is used as straight time (three hours), since the use of the comp time took place in the same FLSA
work cycle.) Comp time is allowed at the discretion of the Elected Official/Department Director. Comp
time must be provided in accordance with an agreement or understanding with employees prior to the
time being worked. The employee has the right to request the use of accumulated comp time.
Department/office administrators must allow for the use of the comp time within a reasonable period
IROORZLQJWKHHPSOR\HH¶VUHquest to take the time off unless the operation of the government would be XQGXO\ GLVUXSWHG E\ WKH HPSOR\HH¶V DEVHQFH IURP ZRUN 7KHHPSOR\HH LV HQWLWOHG WR UHFHLYH IXOO
compensation for unused accumulated comp time when employment is terminated.
The FLSA UHTXLUHVWKHSD\LQJRXWRIRU³FDVKLQJRXW´RIFRPSWLPHXSRQVHSDUDWLRQIURPAugusta,
Georgia service. When compensatory time is cashed out upon separation of employment, it must be paid
at the regular rate the employee is earning at the time it is cashed out, or the average regular rate received
by the employee during the past three years, whichever is higher.
Attachment number 2
Page 98 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 99 | P a g e
Formatted: Centered
Department Directors/Elected Officials may choose to cash out comp time periodically at any time during WKHHPSOR\HH¶VWHQXUHZLWKWKHapproval of the Augusta, Georgia Board of Commissioners. When time is
cashed out by a Department/Office on occasions other than separation from Augusta, Georgia service, it
must be paid at the regular rate the employee is earning at the time it is cashed out. (Funds must be
available in the department budget for use in cashing out comp time.)
Section 500.132 Maximum Comp Time Accrual
The FLSA establishes the maximum amount of comp time that employees can accrue. The maximum
accrual limit for employees engaged in work associated with public safety, emergency response and
seasonal work is 480 hours. For employees in all other areas, the maximum accrual is 240 hours. Any
hours worked over these limits must be paid to the non-exempt employee.
Section 500.133 Employees Transferring From One Department/Office to Another
When non-exempt employee with a comp time balance transfers from one department/office to another,
the department/office from which the employee is transferring is responsible for cashing out the comp
time balance and paying the employee prior to the effective date of the transfer.
Section 500.134 Amendment of Salary Administration Program
The Administrator shall have the authority to approve all classifications, reclassifications, pay adjustments
up to fifteen percent (15%) of base pay and final decision authority of classification appeals.
The Administrator, when necessary, may request a meeting with the Human Resources Director for the
purpose of amending the Salary Administration Program and to conduct a salary and wage
competitiveness examination. Based upon this examination, the Human Resources Director will present
recommendations for revisions in the Salary Administration Program to the Administrator for appropriate
action. When reviewed by the Administrator and approved by the Board of Commissioners, the Salary
Administration Program shall constitute Augusta, Georgia's pay schedule and shall be effective until such
time as the Administrator deems necessary to effect changes.
Section 500.135 Interim Pay Policy
The purpose for this policy is to provide a salary adjustment to employees who are placed in an interim
position. An individual serving on an interim basis in a position at a higher salary will be based on the
policy provided in Section 500.118 herein. This policy will only whereas applies when the position will
be vacant for at least thirty (30) days.
Interim Pay Amount:
The following adjustments will be provided to employee who is in the interim position based on the
following criteria:
1. Employees will be moved to the entry level pay of the job grade of the vacant position or the
employee will receive a fifteen percent (15%) increase, whichever is less. The Administrator may
approve additional increase of up to fifteen per cent (15%) if funds are available.
2. At the end of the interim term, the adjustment will be eliminated and the employee will return to
their previous salary. There will be no exceptions to this guideline.
Attachment number 2
Page 99 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 100 | P a g e
Formatted: Centered
Approval:
All interim salary adjustments must be approved in accordance with this policy and Section 500.118
before any salary adjustment is to be implemented. All salary adjustments will be implemented at the
beginning of the pay period following approval. Adjustment will not be made during a pay period.
Procedure:
All salary adjustments must be submitted in writing to the Human Resources Director and must include
the following:
1. A memorandum justifying the salary adjustment including the names of both the person who will
be out and the person to be placed in the interim position.
2. A time frame that states the length of the salary adjustment, not to exceed 90 days.
3. If more than ninety (90) days is needed, another request justifying the need should be submitted in
writing and will require the appropriate approval.
C. POSITION CLASSIFICATION PLAN
Section 500.201 Classification Plan
The Administrator shall have the authority to approve all classifications, reclassifications, pay adjustments
and final decision authority of classification appeals, except as otherwise provided.
A. Purpose of the Plan
The position classification plan provides a systematic arrangement of the positions in the Augusta,
Georgia workforce. The plan groups the various positions into classes with appropriate titles, description
of duties, responsibilities, and types of work performed. Each description lists the minimum requirements
and qualifications needed to perform the job. By describing job duties, responsibilities, and qualifications,
the classification plan provides guidelines for establishing a pay plan based on these relationships.
B. Uses of the Plan
The Classification Plan shall be utilized to -
1. Establish qualifications; prepare examination announcements, and examination content
2. Determine salaries to be paid for the various classes of work.
3. Determine lines of promotion.
4. Develop an employee training program.
5. Provide an understandable and uniform terminology of jobs.
Attachment number 2
Page 100 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 101 | P a g e
Formatted: Centered
C. Content of the Plan
The Classification Plan shall consist of -
1. A grouping of positions into classes on the basis of approximately equal difficulty and
responsibility which require the same general qualification, and which can be equitably
compensated within the same pay grade.
2. There are two types of classification titles:
Approved Job Title ± are approved by the Administrator and cannot be changed by a Department
Director. The Human Resources Director may recommend a job title change approval at anytime
to the Administrator.
Working Job Title- may be changed by a Department Director upon written notice to the Human
Resources Department. Prior to changing the Working Job Title, a Department Director must
consult with Human Resources Compensation Administration unit. The Human Resources
Department shall update records to reflect any job tile changes.
Augusta, Georgia Human Resources Compensation Administration unit shall administer a job title system
that groups non-represented jobs into related and logical progressions. Jobs are organized by field, which
is a broad occupational grouping (for example, Information Technology would be a job field). Within
each field is a group of job families, which are more specific, such as the Database Administration family.
Within each family are categories of jobs, which describe the nature of work performed, such as
Professional or Supervisory & Managerial. Lastly, within each category there are different levels of jobs.
For example, for professionals within the Database Administration family there is a Database
Administrator 1, 2, 3, 4 and 5. Not all families have every category or level ± only those that are required
to represent current jobs.
By developing organization-wide career progressions, job families can serve as a starting point for our
discussions around career development. Jobs in the new structure shall be assigned new, standardized
titles. The new titles are based on industry-standard job titles, which are commonly found in government
organizations nation-wide and in professional salary surveys.
The intent is that all employees who perform the same type of work at the same level of expertise will be
assigned the same organization-wide job title and pay grade. For example, all entry-level Accountants DFURVVWKHRUJDQL]DWLRQZLOOKDYHWKHWLWOHRI³$FFRXQWDQW´DQGZLOOKDYHWKHVDPHSD\JUDGH
The Approved Job Title, indicative of the work of the class, shall be used on all personnel, accounting,
budget and related official records. No person shall be appointed to a position that is not a job title
approved by the Administrator.
Written job descriptions for each job classification containing the nature of work and relative
responsibilities of the class, typical illustrative tasks found in the class, requirements of the class setting
forth the necessary knowledge, skills, and abilities required for adequate performance of the work, and the
desirable experience and training needed for recruiting to the class will be drafted and maintained by the
Human Resources Department.
Attachment number 2
Page 101 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 102 | P a g e
Formatted: Centered
D. Adoption of the Classification Plan
The Plan shall be prepared by the Human Resources Director with such assistance as necessary and shall
be presented to the Administrator for approval.
E. Changes in the Classification Plan
The addition of new classes or deletion of existing classes shall be accomplished in the same manner as
the original adoption of the Plan.
F. Maintenance of the Classification Plan
The Human Resources Department shall be charged with the responsibility of maintaining the
Classification Plan and providing for the continued, proper allocation of the employees in the Classified
Service:
1. On the basis of studies made by the Human Resources Department on new or proposed positions
and on the recommendations resulting there from, the Human Resources Director shall, place the
position in the proper class reflecting the duties and responsibilities of the work.
2. On the basis of studies made by the Human Resources Department and on the recommendations
resulting there from, the HR Director may propose to the Administrator a reclassification of
positions to the proper classification. 7KH $GPLQLVWUDWRU¶V GHFLVLRQ UHJDUGLQJ UHFODVVLILFDWLRQV
shall be final.
Section 500.202 Position Descriptions (Class Specifications)
Class specifications are very general descriptions of the duties and tasks of positions in the organization.
Employees shall have a class specification associated with their official position. It shall describe
examples of actual tasks performed in a generic manner, including the essential functions of the position
and physical abilities generally required to perform those essential functions. An approved position
description template by the Human Resources Director shall be used by all Department Directors at all
times.
Section 500.203 Official Copy of Class and Position Descriptions
A master set of all approved class and position descriptions, which shall constitute the official
Classification Plan, shall be maintained in the Human Resources Department. The official copy shall
show all amendments to the original plan. All approved job classes can be found in the Human Resources
Compensation website (intranet).
Section 500.204 Titles of Positions
The approved job title of a position shall be used to designate the position in all budget estimates, payrolls
and other official records, documents, vouchers and communications in connection with all personnel
processes. Other working titles may be used for a position, if desired, by the Appointing Authority for
purposes not involving a personnel process. Approved job titles may be changed only with the approval of
the Human Resources Director and the Administrator.
Attachment number 2
Page 102 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 103 | P a g e
Formatted: Centered
Section 500.205 Minimum Qualifications
Minimum qualifications are comprehensive statements of the minimum skills, experience, education and
abilities necessary to perform the essential functions of the job.
Section 500.206 Procedures for the Allocation of Positions
The Human Resources department is responsible for ensuring that all classified positions are allocated
and, after consulting with the affected employee(s) (if applicable) and his or her Department Director or
Appointing Authority, recommending to the Administrator or designee the appropriate class of each
position.
Every position shall be placed in the appropriate class before final administrative action can be taken on
appointments, transfers, promotions, changes in pay grade or payment of salary involving the position.
Those positions which are sufficiently similar with regard to duties performed, level of responsibility,
minimum requirements of training, experience, or skills and which merit approximately equal pay shall be
allocated to the same class.
A complete set of written specifications for each job classification including any special entrance
qualifications for particular classes shall be maintained by the Human Resources Department. When new
positions are approved in the budget, the Human Resources department shall create new class
specifications and assign them to an appropriate class.
In order to propose a new position, a Department director shall provide to the Human Resources Director
a job description of the position, a completed Position Description Questionnaire (PDQ), and both current
and proposed organization charts. A field audit and/or oral interview with a department representative
shall be required by the Human Resources Department in order to verify the information provided on the
PDQ. The Human Resources Director or the designee conducts a market analysis of the position to
determine appropriate pay grade and salary range of the position, and then recommends approval to the
Administrator or designee all proposed actions for reclassifications, additions, deletions and reallocations.
All position requisitions except a backfill position (a backfill position is a position that has been declared
vacant due to voluntary or involuntary separation of the incumbent from the position) should be
forwarded to Compensation Administration for review to determine appropriate pay grade and salary
range of the position. A position requisition that is a backfill should not be forwarded to Compensation XQOHVVWKHSRVLWLRQ¶VGXWLHVDQGUHVSRQVLELOLWLHVKDYHFKDQJHGVXEVWDQWLDOO\E\ILfteen percent (15%) or
more. Supervisors are to certify to the Human Resources Director that there are substantial changes in the
position as mentioned above and that sufficient funding exists to pay for the specific position.
Section 500.207 Procedures and Conditions for the Reallocation of Positions
The Human Resources Director may recommend approval to the Administrator or designee for the
reallocation of existing vacant positions when it is determined that the position is incorrectly allocated.
Such action is called reallocation and must be approved by the Administrator or designee. The
Administrator may reallocate a vacant position when provided with appropriate justification from the
Department Director/Appointing Authority.
Reallocations may occur as the result of the conditions described below:
Attachment number 2
Page 103 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 104 | P a g e
Formatted: Centered
1. The position was incorrectly allocated initially and there have been no substantial changes in
duties; or
2. There has been a substantial change in the duties and responsibilities or qualifications associated
with a position since it was allocated to a particular class.
If a position is assigned a higher pay grade than the current classification, such action is considered an
upgrade of the position. If the position is occupied at the time of the upgrade and the incumbent has
occupied that position for a minimum of six (6) months prior to the re-grade, the incumbent may be
reclassified without examination and funding certification has been done by the supervisor, if the
employee meets the minimum qualifications of the new classification.
If the position is reallocated and the pay grade is not changed, the incumbent may be reclassified without
examination providing the employee meets the minimum qualifications.
If the position is assigned a lower pay grade than the current classification, this change is called a
downgrade of the position. If the position is occupied, the incumbent will be reclassified and continue at
the same pay and receive increases to the maximum of the range of the lower grade. If the current salary
is above the maximum for the lower class, the employee shall be permitted to continue at the present rate
of pay until the current salary falls within the lower grade range.
In all cases of reallocation, if the position is vacant, it shall be filled in the prescribed manner according to
the established process.
In all cases of reallocation of an occupied position, the incumbent is reclassified consistent with the new
allocation provided the incumbent meets the minimum qualifications for the position. The review date of
the incumbent is not changed by such action. Any employee affected by the reallocation of his or her
position may file a written request for reconsideration to the Human Resources Director.
If the position is part of a specified job grouping where each successive increase is dependent upon
receiving a higher level certification, license or other specified qualification, and promotion to the next
level in the job grouping is automatic upon receipt of said certificate or license, the Human Resources
Director may authorize the reallocation of the position and the reclassification of the incumbent without
further review or approval if funds have been approved in the budget. The Human Resources Director
reviews request for reallocation and recommends to the Administrator suitable action.
Section 500.208 Procedures for the Re-grading of Positions
The Human Resources Director may recommend approval to the Administrator or designee for a change
in pay grade of existing positions when it is determined through re-evaluation of the position that the pay
grade needs to be adjusted. Such action is called re-grading and must be approved by the Administrator or
designee. Re-grading may occur as a result of the position being re-evaluated when compared to
comparable jobs within the market without any substantial changes in duties. If a position is assigned a
higher pay grade than the current classification, such action is considered an upgrade of the position. In
order for a position to be re-graded to a higher position, the job duties and responsibilities must have
changed by a minimum of fifteen percent (15%). Any position re-grade or higher level changes not
meeting the fifteen percent (15%) change in duties and responsibilities of the position shall not merit a
shift in pay grade or any salary movement.
Attachment number 2
Page 104 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 105 | P a g e
Formatted: Centered
Section 500.209 Maintenance of the Classification Plan
To fill a job vacancy, the Department Director or Appointing Authority must initiate a request which will
include a statement that the essential job functions and qualifications are still the same, or if different,
must include a position description questionnaire (PDQ) form outlining the current duties and
responsibilities for the position. When a department or division is reorganized, the Department Director or
Appointing Authority shall submit new position description questionnaires (PDQ) for all affected
positions, including justification for re-organization showing significant cost reduction, improved
productivity and efficiency as a result of the reorganization. In addition, the Department Director shall
furnish department organization charts (old and new), and qualifications of each incumbent (if position
was advertised only for internal candidates) of the new position to the Human Resources Director.
Any change, except as indicated in these policies, in the Classification Plan, such as establishing new
classes, abolishing classes, reallocating classes or pay grade changes for classes require the prior approval
by the Human Resources Director and approval by the Administrator or designee if it impacts current
fiscal year budget.
Section 500.210 Departmental Reorganization/Reclassification Policies and Procedures
Authority of the Administrator
The Administrator shall have the authority to approve all classifications, re-organizations, and
reclassifications; pay adjustments up to fifteen percent (15%) of base pay and final decision authority of
classification appeals.
Introduction - $XJXVWD*HRUJLD¶V classification system was designed to group positions together which have similar
duties, have approximately the same levels of complexity and responsibility, require similar training and
experience at the time of recruitment, and uses pay grades which allow for compensation within the same
pay ranges for comparable positions. Reclassification of an existing position shall be based upon VLJQLILFDQW FKDQJHV QRUPDOO\ PLQLPXP RI ILIWHHQ SHUFHQW RI WKH SRVLWLRQ¶V GXWLHV DQG
responsibilities) in a position such that the new job duties and responsibilities are no longer appropriately
placed in the current compensation system within the department. Such changes should be reflected in
factors as increases in the level of training or skills, knowledge, responsibility, scope of supervision (if
applicable), working conditions and accountability. The Reclassification System should not be used to
UHZDUGRUSXQLVKWKHLQFXPEHQW¶VSHUIRUPDQFHWRFLUFXPYHQWWKHUDLVHUHFRPPHQGDWLRQVWRUHFRJQL]HWKHLQFXPEHQW¶VYolume of work, dependability, loyalty or financial need. Reclassification may result in a
position upgrade that necessitates an increase in salary or it could result in a position downgrade to a
lower pay grade.
In an effort to reduce costs, improve efficiency and productivity, Department Directors may have a bona-
fide need to reorganize their department, create new position(s), eliminate unnecessary position(s), or
reclassify existing position(s). Prior to attempting to implement a reorganization, department Directors
should initiate a discussion with the Human Resources Director and Augusta, Georgia Law Department,
as applicable, to help determine the feasibility, appropriateness, compliance with all applicable
employment laws (i.e., FLSA, Equal Pay Act, etc.) and organizational savings associated with the
proposal.
Attachment number 2
Page 105 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 106 | P a g e
Formatted: Centered
Overview
Any requests for reorganization must first be submitted to the Human Resources Director for initial
review. The HR Director shall recommend to the Administrator suitable action. Justification for overall
net cost-savings and/or data supporting any improvement or efficiency resulting from departmental
reorganization. Availability of appropriate funding in current budget for the position(s) in question,
consolidation of duties, responsibilities, etc., that will produce tangible efficiencies in operations or
measurable quality of customer service.
Special Note
Any requests for departmental reorganization / reclassification not in conformance with this policy will
not be processed by the Human Resources Department
Submission Procedures to Human Resources Department
The Department Director must attach a memo that will help make a business case for the reclassification
or reorganization request. The following items must be provided by Department Director or designee to
the Human Resources Director when submitting a reclassification or re-organization proposal:
a. Position control information for current and proposed organization (obtain from finance
department);
b. Name, pay rate and grade for all incumbents;
c. Position(s) that will be abolished, respective savings, productivity and efficiency improvement to
be realized;
d. Addition/deletion of duties and responsibilities for all positions that are proposed for
reclassification;
e. Current and proposed organizational charts (for your department);
f. Proposed job description for all positions and PDQ as appropriate; and
g. Availability of funding in the current Fiscal Year to support the reorganization.
Plans to request a review of position(s) for next yeaU¶VEXGJHWVKDOOEHIRUZDUGHGWRWKH+XPDQ5HVRXUFHV
Director. A preliminary review of position(s) shall be performed by the Human Resources Department. If DSSURYHGE\WKH$GPLQLVWUDWRUWKHSRVLWLRQLVWKHQSXWLQWRQH[W\HDU¶VEXGJHWLIIXQGLQJLVQRWDvailable
for present fiscal year budget.
Any request will not be processed without these documents. The length of time for the review or
reclassification requests by Human Resources and the Commission will depend on factors such as the
complexity of the review and the number of reclassification and/or reorganizations that are in process.
Section 500.211 Conducting a Job Audit
From time to time, the Human Resources Director may order an audit of a single or multiple position(s) in
one department, selected departments, or all departments, as deemed necessary. Should the Human
Resources Director order an audit, the results of the audit will be made available to the Administrator and
Department Director(s). The process of the job audit is as follows:
1. A representative of the Human Resources Compensation Administration Unit, on the Human
5HVRXUFHV'LUHFWRU¶VGLUHFWLYHWRFRQGXFWVXFKDXGLWVKDOOILUVWVFKHGXOHDQDSSRLQWPHQWZLWKWKH
Department Director confirming the date, time and place of the audit.
2. The Department Director(s) shall notify incumbent(s) of the position(s) of audit date.
Attachment number 2
Page 106 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 107 | P a g e
Formatted: Centered
3. A Compensation Administration representative shall utilize an approved Job Audit form and/or
Position Description Questionnaire (PDQ) for this purpose. The cooperation of
employee/supervisor are required.
4. A Compensation Administration representative may interview the Department Director,
immediate supervisor, and/or incumbent
5. Results of the audit shall be forwarded to the Human Resources Director.
6. The Human Resources Director shall notify Department Director of the results of the audit.
7. A copy of the audit result(s) and Compensation Administration recommendations may be
forwarded to the Administrator for financial approval.
Job Audit or Reclassification Requests
The department Director shall review each employees request first and if deemed appropriate,
recommends or submit the request to the Human Resources Director.
Section 500.212 Administrative Review of Reclassifications, Reallocations, and Reorganizations
Employee Initiated
Any employee who feels that his or her position was adversely effected by a reclassification, reallocation,
and/or reorganization may seek reconsideration of the adverse action by submitting to his or her
Department Director the reasons the adverse action was inappropriate. If the Department Director deems
that reconsideration is appropriate, the Department Director shall complete the steps under Department
Director initiated appeals below. If the Department Director does not believe that reconsideration is
appropriate, the Department Director shall provide the employee with a written explanation why
reconsideration in not appropriate.
Department Director Initiated
Of his or her own will or at the request of an employee, a Department Director may seek reconsideration
of any position adversely effected by a reclassification, reallocation, and/or reorganization. In order to
seek a reconsideration, the Department Director shall submit the following to the Human Resources
Director:
a. Position control information for current and previous position (obtain from finance department);
b. Name, pay rate and grade for the position at issue;
c. Addition/deletion of duties and responsibilities for the position at issue;
d. Current and proposed (if reconsideration granted) organizational charts (for your department);
e. Proposed job description for position at issue; and
f. Availability of funding in the current Fiscal Year to support the reconsideration.
Upon receipt of this information, the Human Resources Director will reconsider the adverse impact upon
the position at issue. If the Human Resources Director grants the reconsideration, steps will be taken to
institute the reconsideration. If the Human Resources Director denies the reconsideration, the Department
Director will be provided a written explanation why the reconsideration was denied.
D. OTHER COMPENSATION-RELATED POLICIES
Section 500.301 Compliance
Augusta, Georgia¶V&RPSHQVDWLRQ3ROLFLHVDQG3URFHGXUHV0DQXDOZDVGHYHORSHGDQGLPSOHPHQWHGWR
provide administrative guidance for compliance with the Fair Labor Standards Act of 1938 as amended
Attachment number 2
Page 107 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 108 | P a g e
Formatted: Centered
and Title VII of the Civil Rights Act, as amended.
Section 500.302 Interpretations
Questions concerning the interpretation of these policies and procedures should be directed to Human
Resources Director. Any disagreement between a Department Director and Human Resources Director as
to the interpretation of this policy will be referred to the Administrator.
Section 500.303 Petitions
It is the desire of Augusta, Georgia to address employee complaints concerning the administration of the
Plan first on an informal basis. Both management and employees are expected to make every effort to
resolve disagreements.
Section 500.304 Minimum Wage Policy
Augusta, Georgia adheres strictly to both the U.S. Department of Labor and the Georgia Department of /DERU¶VPLQLPXPZDJHUHTXLUHPHQWs. The minimum hourly wage paid to all staff, including part time,
temporary, and limited service employees, is regulated by the current U.S. Department of Labor federal
minimum wage or Georgia Department of Labor minimum wage whichever is higher.
Section 500.305 Red Circle Rate
Employees who are above the maximum of their salary grade are ineligible to receive any additional
increase to the base salary.
However, if an employee is rated as ³([FHHGV´in an overall evaluation during the annual review process,
the employee will be eligible for a lump sum payment equal to their full amount of merit on an annual EDVLV,IWKHHPSOR\HHUHFHLYHVD³0HHW([SHFWDWLRQV´UDWLQJRQWKHLUUHYLHZWKHHPSOR\HH ZLOOEH
eligible for a lump sum payment equal to one-half of their merit increase on an annual basis. This policy
is effective from date of approval of this policy manual. This policy is subject to approval of budget and
availability of funds.
Section 500.306 Green Circle Rate
Green Circle Rate is the rate of pay that is less than the minimum established rate for that pay grade. An
employee SDLGXQGHUWKLVFLUFXPVWDQFHZLOOEHHOLJLEOHIRULQFUHDVHVWKDWZLOOEULQJWKDWSHUVRQ¶VVDODU\XS
to the minimum of the salary range depending on availability of funds. The Human Resources Director
and the Administrator may make the adjustment as deemed necessary.
Section 500.307 Base Step Increases or Within Grade Increases Pay Schedules
Note: The following is a BASE Within-grade Increases Pay Schedule Policy. All Augusta, Georgia
employees that satisfy the requirements of this policy shall receive pay adjustments above the base pay
when funds are available.
Attachment number 2
Page 108 of 269
Item # 11
Attachment number 2
Page 109 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 110 | P a g e
Formatted: Centered
Permanent Positions
WGIs apply only to Augusta, Georgia employees occupying permanent positions. "Permanent position"
means a position filled by an employee whose appointment is not designated as temporary and does not
have a definite time limitation of 1 year or less. "Permanent position" includes a position to which an
employee is promoted on a temporary or term basis for at least 1 year.
Required Waiting Periods
For employees with a scheduled tour of duty, the required waiting periods established by Augusta,
Georgia for advancement to the next higher step are as follows:
Advancement from... Requires...
step 1 to step 2 52 weeks of creditable service at step 1
step 2 to step 3 52 weeks of creditable service at step 2
step 3 to step 4 52 weeks of creditable service in step 3
step 4 to step 5 104 weeks of creditable service in step 4
step 5 to step 6 104 weeks of creditable service in step 5
step 6 to step 7 104 weeks of creditable service in step 6
step 7 to step 8 156 weeks of creditable service in step 7
step 8 to step 9 156 weeks of creditable service in step 8
step 9 to step 10 156 weeks of creditable service in step 9
Example of a Step Increase
Section 500.308 Senior Executive Service (SES) Group
The Senior Executive Service (SES) Group consists of key executive level employees of the organization.
SES employees are employees-at-will throughout the term of their employment and do not obtain a
property interest in their position at any time. SES employees are not entitled to appeal their terminations
to the Personnel Board.
Step 1 Step 2 Step 3 Step 4 Step 5 Step 6 Step 7 Step 8 Step 9 Step 10
From Pay
Grade
Minimum
To Pay
Grade
Maximum
Grade
Within
Pay
Grade
Amount
30 $14,011.44 $24,019.62 17803 18398 18990 19579 20171 20519 21104 21694 21717 22269 VARIES
31 $14,748.89 $25,283.81 *1.5% *1.5% *1.5% *1.5% *1.5% *1.5% *1.5% *1.5% *1.5% *1.5% VARIES
32 $15,525.15 $26,614.54 *1.5% *1.5% *1.5% *1.5% *1.5% *1.5% *1.5% *1.5% *1.5% *1.5% $0.00
Attachment number 2
Page 110 of 269
Item # 11
Attachment number 2
Page 111 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 112 | P a g e
Formatted: Centered
The following poVLWLRQVDUHLGHQWLILHGDQGFRQILUPHGDV$XJXVWD*HRUJLD¶V6(6*URXS
SES
Group
Organizational
Job Title
SES
Group
Organizational
Job Title
SES
Group
Organizational
Job Title
IV Administrator II Recreation Director I Board of
Elections
Director
IV General Counsel II Utilities Director I Daniel Field
Director
IV Clerk of
Commission
II Engineering
Director
I Animal Services
Director
IV EEO Director II Solid Waste
Director
I Staff Attorney
IV DBE Federal
Program
II Human Resources
Director
I Transit Director
II Finance Director I Warden
II Tax Assessor I Housing &
Community
Development
Director
III Deputy
Administrator
II Emergency
Management
Service (EMA)
Director
I Fire Chief
III Deputy
Administrator
II Information
Technology Director
I Facilities and
Maintenance
Director
III Airport Executive
Director
II Procurement
Director
III Deputy General
Counsel
II License &
Inspections/Planning
& Zoning Director
II Senior Staff
Attorney
II Environmental
Services Director
Section 500.309 Immediate Vesting for SES Employees
Senior Executive Service (SES) level employees employed with Augusta, Georgia as of the effective date
of this policy and hire thereafter shall be 100% vested in their normal retirement benefit immediately
upon becoming a participant in Augusta, Georgia pension plan.
Section 500.310 SES Group Member Affected by Reduction in Work Force
If a SES Group member 1) is involuntarily separated from employment with Augusta, Georgia in
accordance with reduction in force guidelines approved by the Augusta, Georgia Board of
Commissioners; 2) is vested in a normal retirement benefit under the terms of this Plan at the time of said
Attachment number 2
Page 112 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 113 | P a g e
Formatted: Centered
separation; 3) is involuntarily separated in accordance with reduction in force guidelines that remain in
effect at the time of the SES Group members separation; and 4) has executed any and all waiver
agreements or releases required by Augusta, Georgia in connection with said reduction in force, then the
SES Group member shall be credited with an additional five (5) years of Credited Service under the
Augusta, Georgia pension plan solely for purposes of computing the amount of any retirement or death
benefit payable to or on behalf under the terms of the pension plan. Said Credited Service shall not be
counted for purposes of meeting the minimum service requirements for vesting or retirement or death
benefit eligibility under the pension plan.
Section 500.311 SES Group Severance Pay
Any SES employee who is terminated without cause, by vote of the Commission, and executes as release
of claims as required and approved by the Human Resources Director, shall receive severance pay,
SXUVXDQWWRWKH$GPLQLVWUDWRU¶VDSSUoval, as follows:
1. SES Groups I-III shall be eligible for one (1) month of severance pay during the first year of
employment and an additional month of severance pay for each additional year worked in a SES
position, not to exceed a maximum of six months of continued pay.
1.1 Employment time serving in a non-SES position will not be credited for prior years of
service under this policy if subsequently promoted to a SES position.
1.2 This policy will not void any contracted agreement currently in effect.
1.3 This policy applies only to the employees serving in the SES level positions
2. SES Group IV shall be eligible for three (3) months severance pay if terminated during the first
year of employment as a SES Group IV employee and twelve months (12) if terminated after
providing at least one (1) year of service as a SES Group IV employee. In addition, such
employees shall be eligible to receive an additional month of severance for each additional year
worked as a SES level IV employee not to exceed a maximum of twelve (12) additional months of
continued pay (for a total not to exceed 24 months).
2.1 Employees that previously served in a non-SES Group IV positions will not be credited
for prior years of service in non-SES Group IV positions.
2.2 This policy will not void any contracted agreement currently in effect.
2.3 This policy applies only to the employees serving in SES Group IV positions.
Section 500.312 Notice of Resignation Required for SES Employees
If a SES Group member voluntarily leaves their position without providing a minimum of ninety (90)
days written notice of resignation, the SES Group member may not be entitled to severance pay. In the
event that an SES Group member is voluntarily leaving the organization, depending on conditions and
availability of a suitable replacement, either interim or permanent, a ninety (90) day written notice may be
waived in all or in part by the Administrator or the Commission.
Attachment number 2
Page 113 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 114 | P a g e
Formatted: Centered
Section 500.313 Moving and Relocation Expenses for SES Employees
Subject to the approval of the Administrator or Commission, newly hired SES employees may be
reimbursed by Augusta, Georgia for relocation expenses, including temporary housing for Employee for
house hunting. Augusta, Georgia may also elect to pay directly for the expenses of moving employee and
his or her household to Augusta, Georgia. Such relocation and moving expenses shall not exceed ten
($10,000) thousand US Dollars. If such expenses exceed ten thousand dollars ($10,000), the
Administrator or the Commission, in its sole discretion, may review and authorize such expenses to
include parking, moving, storage cost, unpacking, temporary housing, and insurance charges. SES
employee agrees to secure at least three (3) bids from reputable moving companies for such services, and
shall use the lowest most responsible and responsive bidder.
Section 500.314 Annual Leave for SES Employees
SES employees will be credited with five (5) years additional service for purposes of determining the rate
at which Annual Leave will accrue. There is no waiting period before SES employees can use Annual
Leave. Annual Leave accrual and carryover for SES employees is capped at three hundred twenty-five
(325) hours.
Section 500.315 SES Employee Probationary Period
SES employees are not subject to normal and customary probationary periods.
Section 500.316 Compensation Inaccuracies and Corrections
It is our policy and practice to accurately compensate employees and to do so in compliance with all
applicable state and federal laws. To ensure that you are paid properly for all time worked and that no
improper deductions are made, you must record correctly all work time and review your paychecks
promptly to identify and to report all errors.
Review Your Pay Stub
We make every effort to ensure our employees are paid correctly. Occasionally, however, mistakes can
happen. When mistakes do happen and are called to our attention, we will promptly make any corrections
necessary. Please review your pay stub when you receive it to make sure it is correct. If you believe a
mistake has occurred or if you have any questions, please use the reporting procedure outlined below.
Non-exempt Employees
If you are classified as a non-exempt employee, you must maintain a record of the total hours you work
each day. These hours must be accurately recorded on a time card that will be provided to you by your
supervisor. Each employee must sign his or her time card to verify that the reported hours worked are
complete and accurate. Your time card must accurately reflect all regular and overtime hours worked, any
absences, late arrivals, early departures and meal breaks. At the end of each week, you should submit
your completed time card to your supervisor for verification and approval. When you receive each pay
check, please verify immediately that you were paid correctly for all regular and overtime hours worked
each work week.
Attachment number 2
Page 114 of 269
Item # 11
Attachment number 2
Page 115 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 116 | P a g e
Formatted: Centered
Attachment number 2
Page 116 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 117 | P a g e
Formatted: Centered
To Report Concerns or Obtain More Information
If you have questions about deductions from your pay, please immediately contact Human Resources. If
you believe you have been subject to any improper deductions or your pay does not accurately reflect
your hours worked, you should immediately report the matter to your supervisor. If the supervisor is
unavailable or if you believe it would be inappropriate to contact that person (or if you have not received
a prompt and fully acceptable reply), you should immediately contact the Director of Human Resources in
Room 601 of the Municipal Building or at (706) 821-2303, the Manager of Payroll, or any other
supervisor with whom you feel comfortable. If you are unsure of who to contact if you have not received
a satisfactory response within five business days after reporting the incident, please immediately contact
the Administrator in Room 801 of the Municipal Building or at (706) 821-2400.
Every report will be fully investigated and corrective action will be taken where appropriate, up to and
including discharge for any employee(s) who violate this policy. In addition, the Company will not allow
any form of retaliation against individuals who report alleged violations of this policy or who cooperate in
the Company's investigation of such reports. Retaliation is unacceptable, and any form of retaliation in
violation of this policy will result in disciplinary action, up to, and including, discharge.
Attachment number 2
Page 117 of 269
Item # 11
Attachment number 2
Page 118 of 269
Item # 11
Attachment number 2
Page 119 of 269
Item # 11
Attachment number 2
Page 120 of 269
Item # 11
Attachment number 2
Page 121 of 269
Item # 11
Attachment number 2
Page 122 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 123 | P a g e
Formatted: Centered
Section 700.004 General Prohibitions
1. Shirts will be tucked in and buttons will be buttoned.
2. Employees who perform outside work, such as maintenance, construction, and general labor are
not permitted to remove their shirts at any time while performing their jobs.
3. Employees with uniforms where caps are part of the uniform shall wear the cap that is
consistent with their uniform and not caps with advertisements, sports teams or logos, or other
company names or logos.
4. No scarves or bandannas are permitted to be worn under an employee's cap.
Section 700.005 Personal Grooming and Hygiene
All employees are required to maintain good personal grooming and personal hygiene.
Section 700.006 Policy Violations
Violations of the dress code and personal appearance will be handled in accordance with the Disciplinary
Policy.
Attachment number 2
Page 123 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 124 | P a g e
Formatted: Centered
CHAPTER VIII.
EMPLOYMENT, RECORDS & HRIS
Section 800.001 Authority of the Administrator
The Administrator shall have final authority regarding all employment issues, but for those pertaining to
department directors or employees who report directly to the Commission, including, but not limited to,
hiring, firing, position classifications, discipline, and organization.
Section 800.002 Nature of Employment
Employment with Augusta, Georgia is at-will, meaning that the employee is free to resign at any time for
any or no reason. Similarly, Augusta, Georgia may terminate the employment relationship at any time for
any or no reason, with or without notice or cause, so long as there is no violation of applicable federal or
state law.
Policies set forth are not intended to create a contract, nor are they to be construed to constitute
contractual obligations of any kind or a contract of employment between Augusta, Georgia and any of its
employees. The provisions have been developed at the discretion of management and, except for its
policy of employment-at-will, may be amended or cancelled at any time, at Augusta, Georgia's sole
discretion.
Section 800.003 Nepotism
1HSRWLVPLVGHILQHGDVWKHEHVWRZDORIRIILFLDOIDYRUVRQRQH¶VUHODWLYHVHVSHFLDOO\LQKLULQJ
Augusta, Georgia employees and officials subject to these policies and procedures are prohibited from
engaging in Nepotism. Every candidate for employment must list on their employment application all
persons that are related to them as defined by this section. Relative, for purposes of this section only, is
defined as a spouse, parent, step-parent, parent-in-law, child, step-child, child-in-law, brother, brother-in-
law, sister, sister-in-law, or persons living in the employee's household.
(A) No relative, as defined in this section shall participate in the process of selecting, interviewing,
hiring, promoting, demoting, evaluating or disciplining a relative.
(B) No relative, as defined in this section, shall be placed, or remain in, a position where he or she is
directly supervised, on a daily basis, by another relative.
(C) An applicant for employment will not be hired when the position they would be placed in would
cause him or her to either -
1) be directly supervised on a daily basis by another relative; or
2) directly supervise another relative on a daily basis.
Department Directors are permitted to make reasonable adjustments to allow related persons to work
together in their departments in accordance with the provisions of this section. However, Department
Directors shall not be required to take unreasonable steps to permit the employment of related persons in
their department.
Attachment number 2
Page 124 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 125 | P a g e
Formatted: Centered
Generational careers, such as fire suppression personnel and law enforcement, are excluded from the
nepotism policy in order to allow multiple generations to work for Augusta, Georgia.
Nothing in this section shall be construed to repeal or modify the Code of Ethics contained in AUGUSTA,
GA, CODE §§1-1-20 through 1-1-26.
Becoming Related During the Course of Employment
If the situation occurs where an employee within a department marries or becomes related by marriage to
another individual within the same department and one relative is in a position where he or she directly
supervises the other relative on a daily basis, the Department Director and the two affected employees
will have thirty (30) days to change the positions of one or both of the related employees such that they
can both work in the same department without violating the nepotism policy. If this is not possible, then
within sixty (60) days of the marriage date, the Director of Human Resources will evaluate the
qualifications of the affected employee who was last hired to see if there is a comparable position
available in another department. If no comparable position is found in another department within sixty
(60) days of the marriage, or if a transfer is offered and declined by the employee, all continued rights of
employment shall cease, and such employee will be separated.
This policy will be applied in accordance with applicable state and federal law, and any employee who
violates the policy will be subject to discipline up to, and including, termination.
Section 800.004 Position Management
Purpose
The Position Management Program (PMP) is the formal system for identifying and defining positions in
Augusta, Georgia to assure compliance with Augusta, Georgia¶V EXGJHW SURJUDP DQG DYDLODELOLW\ RI
funds. A position is a specific functional job within Augusta, Georgia. The PMP is divided into two
distinct components.
i) A unique position numbering system will provide controls for authorized and recognized
positions. The unique number for each position will easily identify the Human Resources criteria
of several programs critical to each position.
ii) The PMP will provide a formal approval process for positions to be included in the budget
program and a means for tracking the status of these positions in relationship to the availability of
funds.
Position Numbering and Control
Each position in the Augusta, Georgia Classified Service will be assigned a Personnel Control Number
(PCN). Utilizing a series of alpha-numeric fields, essential information unique to that position can be
readily obtained. The PCN is divided into three basic subgroups -
i) Position Identifier - This is the basic identifying sequence for the job position. It consists of four
fields that will include the job classification code, the department and division to which it is
assigned, and a sequence number. No two Position Identifiers will be the same.
Attachment number 2
Page 125 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 126 | P a g e
Formatted: Centered
ii) Supplemental Data - The next section of the PCN is a series of fields which will allow Human
Resources to identify the following - Exempt/Nonexempt as defined by the Fair Labor Standards
Act
Position control is a system of tracking information based upon positions rather than employees to create
a framework of positions for all jobs within Augusta, Georgia without regard to whether or not they have
an incumbent in a specific job. As incumbents grow and change jobs within Augusta, Georgia, their job
title, salary and other attributes may change, but the position the incumbent was in will likely still exist
and will be maintained. Position control will allow Augusta, Georgia to track the history of the position,
track vacancies, and track positions filled with temporary and contract workers. The system will bridge
the gap between typical employee information (HRIS) and position information (Budgets).
Position Tracking
Position tracking refers to a system of tracking information based upon a unique position ID number with
the primary purpose of managing positions more precisely and thus enable more accurate monitoring of
the approval process. Approved/funded positions will be tracked as authorized. Positions that are not
approved/funded will be tracked as recognized. Recognized positions will be included on the official
departmental organizational charts maintained by the Human Resources Department, and if future funding
becomes available and approved, they may be moved to authorize status. The system can also track
vacancies, over filling, under filling and full-time equivalents (FTE). Position titles will include the
official title as approved by the approval process and the organization title (e.g., Equipment Operator II
may be known in the department as Bush Hog Driver).
Position Approval Process
The approval process for hiring of all positions will be the Department Director, Human Resources
Director, Finance, and the Administrator.
i) Existing Authorized Positions - The Department Director shall forward a Personnel Action Form
(PAF) to the Human Resources Department. Human Resources will verify that the salary is
within guidelines and forward to OMB to verify funding. The verified PAF will then be forwarded
to the Administrator for approval and returned to Human Resources for normal processing.
ii) New Positions - The Department Director will forward a Position Description draft and a revised
organizational chart to the Human Resources Department. This will document the concept of the
position. The Classification/Compensation Administration will perform the job analysis,
determine whether or not the position should be in the classified or unclassified, and assign a
salary grade. The allocation request will then be forwarded to Finance and the Administrator for
verification of funding and approval.
(a) If funded and approved, the position will be placed into the employment process pursuant
to the relevant Policies and Procedures.
(b) If not funded or approved, the position will be marked as recognized and returned to the
Classification/Compensation Section for recording prior to returning to the Department.
Recognized positions will be suspended for possible future funding or future budget years.
Attachment number 2
Page 126 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 127 | P a g e
Formatted: Centered
Administration
The Human Resources Director shall have responsibility for the implementation and administration of the
Position Management Program.
Section 800.005 Vacant Positions
Vacant positions may be filled by recruitment from inside and/or outside sources as determined
appropriate in coordination with the selecting Department Director, Online Hiring Center (OHC) user or
HR Liaison. While the substantial majority of job vacancies meet the criteria for posting, there are a few
circumstances that do not warrant advertisement of positions.
When a job posting is warranted, vacancies may also be advertised with the local employment
commission, newspapers and electronic media, other government agencies, journals, private recruiting
firms, colleges, professional and civic organizations, DQGRWKHUVRXUFHVDWWKHKLULQJGHSDUWPHQW¶VH[SHQVH
The department must complete a requisition form in NEOGOV to fill any vacancy. This form will
include but is not limited to:
a. Advertising Method (Area of consideration)
i. Internal
1. Departmental
2. Divisional
3. All Employees
ii. External
1. Open to the Public
b. Working Hours and Location
c. Safety Sensitive Position Status
The requisition must undergo several stages of approval:
a. The Director must certify that the requested position is funded.
b. The HR Director or designee must authorize the advertisement of the position.
After a requisition has been approved, an HR representative and the Departmental HR Liaison will review
the most current version of the job description to determine if it needs to be updated or revised. The job
description will provide valuable information to help screen for Minimally Qualified (MQ) and Highly
Qualified (HQ) candidates. Questions from the principle duties and responsibilities, educational
requirements, knowledge, skills and abilities will be used during the automated screening process.
Additionally, an HR representative may contact the HR Liaison for supplementary information regarding WKHSRVLWLRQWRGHWHUPLQHDQ\³6HOHFWLYH3ODFHPHQW)DFWRUV´ 63) VXFKDVVSHFLILFFHUWLILFDWLRQVQHHGHG
for optimal performance or job specific information (i.e. certified aluminum welder, advanced
certification in excel, public speaking experience, or bilingual capabilities).
To ensure that HR is recruiting qualified candidates for the opening, it is essential that the departmental
liaison and HR staff communicate with each other regarding the posting and subsequent activities during
the recruitment process. The hiring department has (48) hours to make any necessary updates to the job
descriptions after the initial job description review. All changes to the job description must be approved
by the HR Director.
Attachment number 2
Page 127 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 128 | P a g e
Formatted: Centered
Section 800.006 Competitive Job Posting Process
All positions must undergo every stage of approval by Wednesday to ensure advertising the following
week. Any position that does not meet the Wednesday deadline will have their advertisement delayed by
a minimum of one week. In order to advertise positions outside of the Augusta, Georgia Website, a fund
site must be designated on the requisition form.
Augusta, Georgia provides employees an opportunity to indicate their interest in open positions and
advance within the organization according to their skills and experience. In general, notices of all full-
time job openings are posted, although Augusta, Georgia reserves the right to not post a particular
opening, as described in Section 800.010 herein
Job posting is a way to inform employees of openings and to identify qualified and interested applicants
who might not otherwise be known to the hiring manager. Other recruiting sources may also be used to
fill open positions in the best interest of the organization.
Job openings for the classified service will be posted on NEOGOV via Human Resources home page
under employment opportunities and normally remain open for (5) five business days. Each job posting
notice will include the dates of the posting period, job title, department, location, grade level, job
summary, essential duties, and qualifications (required skills and abilities).
To be eligible to apply for a posted job, employees must have performed competently for at least six (6)
months in their current position. Employees who have received a written warning in the last twelve (12)
months or are on a disciplinary probation or suspension are not eligible to apply for posted jobs. Eligible
employees can only apply for those posted jobs for which they possess the required skills, competencies,
and qualifications.
An applicant's supervisor may be contacted to verify performance, skills, and attendance. Any staffing
limitations or other circumstances that might affect a prospective transfer may also be discussed.
To apply for an open position, employees should submit a job posting application via NEOGOV to the
Human Resources Department listing job-related skills and accomplishments. It should also describe how
their current experience with Augusta, Georgia and prior work experience and/or education qualifies them
for the position.
Augusta, Georgia recognizes the benefit of developmental experiences and encourages employees to talk
with their supervisors about their career plans. Supervisors are encouraged to support employees' efforts
to gain experience and advance within the organization.
Section 800.007 Competitive Process Exceptions
The following is the listing of special staffing situations that, with the recommendation of the Department
Director (where appropriate) and concurrence of the Human Resources Director, may be exempted from
the competitive job posting process -
i) Reassignments or voluntary transfers at the same or lower grade level. Selecting officials may
consider applicants for vacancies who are willing to accept vacancies at any time.
ii) Management-directed reassignments at the same or lower grade level with no reduction in pay.
Attachment number 2
Page 128 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 129 | P a g e
Formatted: Centered
iii) Reorganizations and reductions in force that require reassignment of effected personnel to newly
created or existing vacancies.
iv) Position upgrades that are currently encumbered that result in reclassifications to a higher grade
level as a result of job accretion.
v) Internal promotions in an approved career ladder are similar WRSRVLWLRQXSJUDGHV LQ³iv´DERYH
and likewise do not require job postings.
Section 800.008 Application Process
The Human Resources Department shall provide the methods and means by which interested parties and
current employees may apply for positions under recruitment. This process includes the use of automated
employment system (NEOGOV) which allows applicants an opportunity to accurately reflect their
education, training, previous work experience, knowledge, skills and abilities. The Human Resources
Department will administer the process.
An applicant must complete an online application and answer all supplemental questions in order to be
considered for employment. Failure to answer the supplemental questions will result in disqualification
of the applicant. The website address is www.augustaga.gov/index.aspx?NID=717 . Applications will
only be received while the position is open. Manual or hand written applications will not be accepted.
Augusta, Georgia relies upon the accuracy of information contained in the employment application, as
well as the accuracy of other data presented throughout the hiring process and employment. Any
misrepresentations, falsifications, or material omissions in any of this information or data may result in
the exclusion of the individual from further consideration for employment or, if the person has been hired,
termination of employment.
Rejection of Applications - The Director of Human Resources or designee may reject an application that
indicates that the applicant is deficient in any or all of the requirements as specified in the public
announcement of the vacancy. An applicant may also be rejected for fraud or deception in the completion
of the application, or if his or her past record of employment is determined to be unsatisfactory by the
Director of Human Resources.
Section 800.009 Applicant Screening
Most positions, unless otherwise identified, will receive the referred list of minimally qualified applicants.
When the referred list is received, interviews are at the discretion of the OHC manager.
a. Basic Qualifications
Human Resources will pre-screen applicants to determine if minimal qualifications are met. Any
applicant that does not meet the minimal qualifications will not be forwarded to the hiring
department.
i. $OO ³EDVLFDOO\ TXDOLILHG´ DSSOLFDQWV ZLOO EH IRUZDUGHd to the hiring department on an
³$SSOLFDQW5HIHUUDO/LVW´ $5/ ,IDQDSSOLFDQWGRHVQRWDSSHDURQWKH$5/WKH\DUHQRW
eligible for hire.
Attachment number 2
Page 129 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 130 | P a g e
Formatted: Centered
ii. If a selection cannot be made from the minimum qualification list, justification for this
reason must be made via NEOGOV (viewable to the applicant) as to why the candidate
was not selected.
b. Highly Qualified Applicants
Some positions may require knowledge, skills and abilities (KSA) examining for highly qualified
candidates. Before advertising, HR and the Department Director or designee, will determine what
qualifications are needed to be designated as highly qualified. Only applicants on the ARL are
eligible for hire.
I. If such screening is required, the top (10) highly qualified candidates will be referred to the
hiring department. If less than (3) highly qualified candidates exist, all qualified
candidates will be forwarded to the hiring department for consideration.
II. If selection cannot be made from the initial top ten and there are remaining highly qualified
candidates, the remaining list will be forwarded to the hiring department.
III. If a selection cannot be made from the highly qualified list, justification for this reason
must be made via NEOGOV (viewable to the applicant) as to why the candidate was not
selected.
IV. 2QO\WKH+5'LUHFWRUFDQDSSURYHVHQGLQJDQHZUHIHUUDOOLVWRIWKH³basically qXDOLILHG´
applicants if all highly qualified applicants are rejected.
c. Referred List: Referred List will remain active for sixty (60) days, after which time the list will
expire and the position must be re-advertised. Extensions may be granted on a case-by-case basis.
d. Fire Department: As to the Fire Department, all applicants for Firefighter positions will be
required to take a written examination and undergo agility and other physical tests as might be
required by the Fire Department. Those applicants successfully completing said written
examination and other tests will be placed on a list established and maintained by the Fire
Department.
Section 800.010 Qualifications and Requirements
Qualifications are the education, experience, competencies, skills, abilities, knowledge, and other
attributes determined most likely to predict successful job performance in a position or group of positions
with similar requirements and levels of responsibilities. Acceptable background information and driving
record, when required, are included in the attributes necessary to meet minimum qualifications.
Documentation of education, certification and veteran status must be provided to Human Resources prior
to employment.
All positions in the classified service shall be open only to persons who meet such requirements as are
listed on the public announcement of the vacancy. Such requirements may include but are not limited to
the following factors - experience, education, and training. Applicants considered for employment/rehire
will be screened for illegal drugs as a part of the employment process. Applicants will also be subject to a
complete background and reference check by the Human Resources Department as well as review of any
relationships prohibited by the nepotism policy.
Applicants for Firefighter positions in the Fire Department will be required to meet such physical
standards (including without limitation height and weight standards) as may be established by the Fire
Department. (Such standards are set forth in the Augusta, Georgia Fire Department Operations Manual
Attachment number 2
Page 130 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 131 | P a g e
Formatted: Centered
(the "Manual")). Applicants for Firefighter positions in the Fire Department will also be required to meet
all standards and requirements of the State of Georgia for employment of Firefighters, including without
limitation the "Employment Requirements" of the Georgia Firefighter Standards and Training Council. A
copy of these requirements is maintained by both the Human Resources Department and the Fire
Department and may be reviewed upon request.
Applicants for Firefighter positions in the Fire Department will also be required to pass such written
examinations, physical examinations, agility tests, and such other requirements as may be set forth in the
section of the Manual entitled "Firefighter Qualifications." SHH DOVR ³)LUH )LJKWHU ,± Recruitment
3URFHGXUHV´EHORZ
Section 800.011 Fire Fighter I ± Recruitment Procedures
Eligibility Requirements - To apply for the position of firefighter, you must -
a) Be at least 18 years of age;
b) Have a High school diploma or equivalent ;
c) Have a valid driver's license and a good driving record;
d) Have a honorable discharge, if any, from the military; and
e) Meet the medical requirements set forth in NFPA 1582.
Disqualifiers may include, but are not limited to, the following -
a) Admission and/or conviction of a felony offense within the past (10) years;
b) Admission and/or conviction of a misdemeanor involving moral turpitude;
c) Admission, conviction, or positive test indicating illegal drug use within the past 12 months;
d) Admission or conviction of the sale of drugs;
e) Admission, conviction, or positive tests indicating certain drug use and/or patterns of drug use;
f) Anything other than an honorable discharge from the military;
g) Admission, conviction, or other evidence of a pattern of theft; or
h) Admission or conviction of DUI (driving under the influence) within the last 5 years
Hiring Procedures
1. Fire Department Interest Form - When not conducting active recruitment, interested persons
PD\FRPSOHWHD³-RE,QWHUHVW&DUG´7KHVHDUHDYDLODEOH on the www.augustaga.gov/employment.
2. Applications - Persons who have completed interest forms are e-mailed a notification that they
now need to complete an online employment application. Once recruitment is open, a position will
be advertised for no less than 30 calendar days.
3. Entrance Exam - All applicants are scheduled to take the Entrance Examination. (The exam is a
nationally validated examination.) This exam is based on general knowledge, measuring numerous
abilities. A passing score is required to progress from the Entrance Exam to the Agility Test. The
Entrance Examination will not be scored on the day of the test, notification will be sent to
applicants advising their results as either passing or failure.
4. Background Check and Pre-employment Screening - Candidates must consent to a background
examination. Candidates will be given a detailed background questionnaire packet at the Entrance
Exam. This form is to be returned to Fire Administration as quickly as possible.
Attachment number 2
Page 131 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 132 | P a g e
Formatted: Centered
5. Agility Test - Candidate Physical Ability Test (CPAT) - All applicants who successfully complete
the entrance exam will progress to the CPAT. A CPAT video will be made available to all
applicants on the August website under Human Resources. Applicants will be provided the
opportunity to practice the CPAT for a minimum of two weeks prior to the test date. Upon
arriving for this test, applicants must sign a waiver to participate in the CPAT. With all forms
submitted, the applicant is allowed to attempt the CPAT. Applicants are notified of their status
(pass/fail) in this segment of the process before they leave the drill yard.
6. Acrophobia Test - All applicants who successfully complete the Entrance Exam and Agility Test
will progress to an acrophobia test. The applicant must sign a waiver and acknowledge that they
are not afraid of heights to participate in this exam. This exercise tests for fear of heights and leg
and hand coordination. The applicant, with a life safety belt on, must climb the ladder to the top,
without stopping and without placing both feet on the same rung at the same time, once at the top
hook the safety snap ring around the second rung from the top of the ladder, lean back taking the
slack out of the safety belt and clap the hands three (3) distinct and separate times over the head.
Unhook the safety belt and descend the ladder to the bottom without stopping. MAXIMUM TIME
- Five (5) Minutes . EQUIPMENT NEEDED - Applicant wears helmet, gloves and ladder belt.
7. Applicant Interview - Applicants who successfully complete all tests are scheduled for a
structured interview before a five (5) member diverse panel to include women and minorities of
various ranks from the Fire department. Human Resources and/or EEO will be present.
8. Candidates List - Candidates who obtain passing status on the Eligibility Exam, normally a score
of 70 or better, and pass all other requirements are then placed on an eligibility list by grouping.
The grouping is based upon total points from the exam, and the candidate interview in the
following categories -
1. Highly Qualified ³+4´ 7RSWRLQFOXGHWLHV
2. %DVLF³%4´ 0LGGOH
3. 0LQLPDOO\4XDOLILHG³04´ %RWWRPWRLQFOXGHWLHV
9. Eligibility List - Candidates successfully moving beyond the background check will be placed on
an eligibility list for consideration in hiring. This list may be used for consideration in selection
for up to one year from the test date.
10. Applicant Referral list - Depending on the number of vacancies, a list of referred candidates will
be forwarded to the Fire Department for hiring consideration. E.g., if the Fire Department has five
vacancies, HR may refer the top 10 candidates in alphabetical order for selection. The applicants
that are not selected will be returned to the eligibility list.
11. Conditional Offer of Employment - As the department needs to fill vacancies, candidates are
scheduled from the eligibility list for a conditional offer of employment. The candidates are to be VHOHFWHGIURPWKH³+4´OLVWILUVW,IWKHUHDUHOHVVWKDQ FDQGLGDWHVRQWKH³+4´OLVWFDQGLGDWHVFDQEHFRQVLGHUHGIURPWKH³%4´OLVW,IWKHUHDUHOHVVWKDQ FDQGLGDWHVRQWKH³%4´OLVW
FDQGLGDWHVPD\EHFRQVLGHUHGIURPWKH³04´OLVWRUWKHSRVLWLRQFDQEHUH-advertised.
12. Drug Test Screening - Within 24 hours of the conditional offer of employment, a drug-screening
test must be conducted and provide negative results.
13. Post Offer/Pre-Employment Medical Examination - Selected candidates will be scheduled for a
complete Firefighter pre-employment medical examination. A trained physician experienced in
Firefighter medical exams will conduct this exam. These exams are conducted to meet the NFPA
1582 standard. This standard can be read in detail at the following internet site, www.nfpa.org.
Attachment number 2
Page 132 of 269
Item # 11
Attachment number 2
Page 133 of 269
Item # 11
Attachment number 2
Page 134 of 269
Item # 11
Attachment number 2
Page 135 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 136 | P a g e
Formatted: Centered
f. Background check authorization; and
g. Education and/or Certification verifications.
Section 800.015 Background Checks
In the interest of public welfare and safety, some positions such as those in public safety, positions that
include working with children, those responsible for handling money and other similar duties, require that
applicants successfully complete background checks including, but not limited to, personal reference
checks, criminal history, child abuse registry and credit history to ensure tKDWWKHDSSOLFDQW¶VSDVWFRQGXFW
is compatible with the nature and requirements of the position under consideration. An applicant for a
position that requires driving a vehicle shall provide a copy of his or her official Department of Motor
Vehicles (DMV) record or shall authorize Augusta, Georgia to obtain a copy of the DMV record. The
applicable department, in conjunction with the Human Resources Department, shall determine the
positions and specific checks that will be utilized. In all cases, appropriate state and federal laws shall be
followed.
No reference check or background investigation will be conducted without first notifying the applicant of
the investigation. The department is responsible for conducting reference checks on their employees.
The Human Resources Department will conduct reference checks on all SES level employees.
Section 800.016 Criminal History
All individuals who are selected for employment to any position with Augusta, Georgia are required to
undergo a criminal history record check. The existence of a conviction does not automatically disqualify
an individual from employment with Augusta, Georgia. Relevant considerations may include, but are not
limited to, the nature and number of the convictions, their dates, and the relationship or nexus that a
conviction has to the duties and responsibilities of the position. Further, any employee or applicant whose
criminal history record information shows a significant arrest or a pattern of recent arrests may be
disqualified from employment until such time as the charge(s) is resolved.
Individuals who have been convicted of a crime listed in this section, or any other offense committed
outside of the State of Georgia that would have been considered one of these crimes if committed in
Georgia, are disqualified from employment as indicated below.
There is a mandatory disqualification from employment in positions subject to criminal history record
checks for a minimum of five (5) years from the date of conviction, plea of nolo contendere, or release
from incarceration or probation, whichever is later, for the following crimes ±
i) Murder or Felony Murder;
ii) Attempted Murder;
iii) Kidnapping;
iv) Rape;
v) Armed Robbery;
vi) Robbery;
vii) Cruelty to Children;
viii) Sexual Offenses;
ix) Aggravated Assault;
x) Aggravated Battery;
xi) Arson;
Attachment number 2
Page 136 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 137 | P a g e
Formatted: Centered
xii) Theft by taking (O.C.G.A. § 16-8-2), by deception (O.C.G.A. § 16-8-3) or by
conversion (O.C.G.A. §16-8-4);
xiii) Forgery (in the first or second degree); and
xiv) Acts of terrorism.
The following minimum sanctions are to be imposed on applicants who have been convicted of a
misdemeanor criminal drug offense -
i) Disqualification from employment in any position for a period of two (2) years from the
date of conviction for the first offense; and
ii) Disqualification from employment in any position for a period of five (5) years from the
most recent date of conviction for the second or subsequent offense.
NOTE - For purposes of this disqualification, ³FRQYLFWLRQGRHVQRWLQFOXGHWUHDWPHQWXQGHr the
Georgia First Offender Act or a plea of nolo contendere. Failure to disclose any misdemeanor or
felony on the employment application could result in disqualification or termination.
The following minimum sanctions are to be imposed on applicants when the position applied for requires
the operation of an Augusta, Georgia vehicle -
i) Disqualification if the applicant has convicted of a DUI in the past seven (7) years; and
ii) Disqualification if the applicant has accrued more than ten (10) points on their license
within the past seven (7) years.
Section 800.017 Rejection
If the applicant does not successfully pass all post-offer employment tests, the Department Director will
be notified and required to make a decision of how to proceed. If the applicant does not accept the job, or
if the applicant does not meet the hiring guidelines (i.e. physical, drug test, background check, etc.), HR
contacts the HR Departmental Liaison to determine the next recruiting action (i.e. offer a higher salary,
re-post the job, contact the alternate applicant and make a CJO, etc.). If an applicant fails a pre-
employment drug screening, they will be barred from applying for one year.
Section 800.018 Final Job Offer (FJO)
After satisfactory completion of all requirements of the conditional job offer stage, a final job offer is
made to the candidate. HR communicates with the candidate to determine the starting dates. After the
starting date is determined, HR notifies the hiring department and finalizes the information. To complete
the hiring process, the department must mark all applicants as either hired or rejected.
Attachment number 2
Page 137 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 138 | P a g e
Formatted: Centered
Section 800.019 Appointments/Transfers
All employees shall be employed upon the recommendation of the Department Director.
1) Initial Appointments -
a) Types of Appointments - When initially hired, persons employed by Augusta, Georgia shall be
given one of the following types of appointment.
i) Probationary - A probationary appointment is an appointment to a position for a probationary
period of twelve (12) months. An employee serving a probationary period may be discharged
or returned to his or her previous position and shall not have the right to utilize the grievance
and appeal procedure set forth in these policies.
ii) Part-time - A part-time appointment is an appointment to a position which indicates the
employee is to work on a continuing basis, but will work less than thirty (30) hours per week.
Part-time employees are not eligible for any benefits.
iii) Regular Appointments - An employee given an initial probationary appointment shall be
given a regular appointment upon satisfactory completion of the probationary period
2) Extraordinary Appointments
a) Temporary Appointment -Temporary appointments shall be utilized to replace regular
employees who are temporarily absent from their duties or to provide extra assistance for short
periods of time. Such appointments may be made from a referral list. The Department Director
may make a temporary appointment through any means necessary to prevent a work stoppage or
slowdown of work that is considered critical to the operations of Augusta, Georgia. The
temporary appointee shall file an Augusta, Georgia application with the Human Resources
Department. The duration of the temporary appointment shall be limited to no more than 1,000
hours. Upon completion of 999 work hours in one calendar year, the temporary appointment
automatically ceases.
The acceptance or refusal of a temporary appRLQWPHQWVKDOOQRWDIIHFWDQDSSOLFDQW¶VHOLJLELOLW\IRU
a probationary or regular appointment. Any person so appointed shall be compensated at the
appropriate rate for the classification to which the temporary position belongs. Upon
recommendation by the Department Director and with the approval of the Human Resources
Director, a temporary appointment may be compensated above the minimum of the pay grade. No
other rights or benefits shall accrue to such person other than federal or state mandates.
Temporary appointees shall not achieve regular status. In order to be considered for regular
employment, a temporary appointee must update his or her application in the Human Resources
Department.
b) Term Appointment - Term appointments shall be utilized by the Departments of Augusta,
Georgia to provide extra assistance for a period of six (6) months to two (2) years. Upon
determining the need for assistance, the Department Director shall submit the Request for
Temporary Employment Service form to the Human Resources Department. The position will be
filled following procedures outlined in the Temporary and Term Employee Contract Procedures.
(Refer to Appendix A, 13.2, Temporary and Term Employee Contract Procedures)
Attachment number 2
Page 138 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 139 | P a g e
Formatted: Centered
Leave may be accrued and used as provided in these Policies and Procedures. Holidays shall be
the same as provided in these Policies and Procedures. No other rights or benefits shall accrue to
such person other than state mandates. Term appointees shall not achieve regular status.
c) Intermittent Appointment - Intermittent appointments shall be placed in established positions
approved by Augusta, Georgia Board of Commissioners. Such appointment shall be made for a
special project or need of a temporary or transitory nature. An intermittent appointee shall be
called in as needed on a weekly or monthly basis. There are no rights or benefits accrued other
than those required by federal or state laws. Intermittent appointees shall not achieve regular
status. Upon recommendation by a Department Director and with the approval of the Human
Resources Director, an intermittent appointment may be compensated above the minimum of the
pay grade.
d) Emergency Appointment - An emergency as used herein means an unforeseen condition that is
likely to cause loss of life or damage to public property such as riots, hurricanes, tornadoes, floods
or other disasters, or situations that require the employment of additional personnel without delay.
The filling of normal vacancies or replacement of regular personnel shall not be classified as an
emergency.
When an emergency arises which requires the immediate services of one or more persons and it is
not possible to immediately secure such persons from an appropriate referral list, and based on
prior approval of the Administrator, the Department Director may appoint such person(s) without
regard to other provisions of these Policies and Procedures governing appointments. Such
appointments shall be limited to the period of the emergency and shall not entitle the appointee to
any rights or benefits under the provisions these Policies and Procedures. The Human Resources
Department shall be immediately advised of every appointment made under the provisions of
these Policies and Procedures.
e) Grant-funded Appointment - Grant-funded appointments are defined as appointments to
temporary positions created and funded under federal, state or other grant agreements. Persons
appointed under this procedure may also be participants of programs designed to benefit
unemployed or underemployed persons. Administrative staff positions of the grant program shall
be employed through regular application and referral list procedures and may also be designated as
grant-funded appointments. Persons who are physically or mentally challenged may also be
appointed under this procedure by special agreements or grants arranged through state or federal
vocational rehabilitation agencies. Any person receiving a grant-funded appointment shall be
informed as to the terms and conditions of the appointment, the grant, and/or agreements relating
to the appointment. The employment of such persons shall be terminated either upon expiration of
the grant or as planned in any other form of agreement. There are no layoff rights.
All benefits and pay are subject to the availability of funds as provided for in the grant agreement.
i) No rate of pay shall be higher than rates paid to employees similarly employed.
ii) Leaves may be accrued and taken if provided for within the grant agreement but not in excess
of that which is provided for under these Policies and Procedures.
iii) Holidays shall be the same as provided in these Policies and Procedures.
Attachment number 2
Page 139 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 140 | P a g e
Formatted: Centered
iv) All other benefits shall be those set forth in the grant or the special agreements in compliance
with applicable laws and regulations governing such.
v) Position creation, classification or reclassification, and pay grade assignments may be
accomplished in order to accommodate special grants or agreements made through federal and
state vocational agencies in conjunction with the efforts to carry out vocational rehabilitation
programs for challenged persons.
g) Student Appointment - A student is defined as an employee who is currently enrolled as a full-
time or part-time student or certifies intent to enroll the next term in an accredited secondary
school, college, vocational school or university. Employment shall be limited to 1400 hours in DQ\WZHOYH PRQWKSHULRGVWDUWLQJZLWKWKHVWXGHQW¶VEHJLQQLng date of employment. No other
rights or benefits shall accrue to such person while serving in a student appointment.
The Department Director may nominate a person to fill the position. The appointee under
consideration shall file an application with tKH+XPDQ5HVRXUFHV'HSDUWPHQW,IVXFKSHUVRQ¶V
qualifications are certified by the Human Resources Department as meeting the minimum
qualifications for the position, the Human Resources Department will prepare and deliver the
conditional job offer to the candidate. Upon request of the Human Resources Department, the
student shall submit documentation of student status to be eligible for continued employment.
h) Private Sector Temp - Persons employed by an outside agency and contracted out for a duration
of time. Human Resources will coordinate the process between the department and the staffing
agency.
4) Promotions and Transfers - It shall be the policy of Augusta, Georgia to fill vacancies in the
classified service, as far as practicable, by promotion of existing employees. To this end, closed
examinations may be held at the call and under the direction of the Director of Human Resources.
a) Political or Partisan Endorsement Prohibited - Promotions to positions in the classified service
shall be based upon job performance and qualification for promotion only. No consideration shall
be given to political or partisan endorsement.
b) Intra-Departmental Transfers - The appropriate department director may, at any time, transfer
an employee in the classified service under his or her jurisdiction from one position to another in
the same class in the same department. An intra-departmental transfer of an employee to a position
in another class shall be made only between classes within the same pay ranges. The Human
Resources Department shall be notified of such changes in assignment.
c) Inter-Departmental Transfers - A transfer of an employee from one department to another
shall require the approval of both department heads concerned. Requests for such transfer shall
explain how the employee concerned meets the qualification requirements of the class to which
the transfer is proposed.
d) Promotional Examinations - The Director of Human Resources shall conduct competitive
promotional examinations in accordance with these policies and procedures. In competitive
promotional examinations, the Director of Human Resources shall admit only those employees to
the examination who meet the published qualification requirements.
Attachment number 2
Page 140 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 141 | P a g e
Formatted: Centered
e) Illegal Substances Screening - Any employee considered for promotion and/or transfer to a
safety-sensitive position will be required to pass an illegal substances screening prior to being
awarded such promotion and/or transfer.
f) Promotion and Transfer Probation - Individuals promoted, advanced, or transferred will serve
on a probationary basis for twelve (12) months from the effective date of promotion or transfer. If,
during the probation period, it is determined that the individual cannot adequately perform the
position, that employee will be returned to his or her previous position if that position has not been
filled. If that position has been filled, the employee will be placed in another available vacant
position for which he or she is qualified. If no positions are available, the employee will be laid
off.
Section 800.020 Probation Periods
No employee shall have a property interest in his or her position during any probationary period. During
any probationary period, the employee may be terminated or returned to his or her previous position
without notice.
a) Duration - The probationary period shall be twelve (12) months in duration.
b) Promotional and Transfer Probation - The probationary period shall be used in connection with
promotions in the same manner as it is used for new hires.
c) Interruption of Probationary Period - If an employee is laid off during a probationary period
and such person is subsequently re-appointed in the same department, he or she may be given
credit for the portion of the probationary period completed before they are laid off.
d) Probationary Period Reports - Probationary performance evaluations are conducted by the
employee's immediate supervisor or Department Director. Probationary employees will be
evaluated quarterly during the probationary period. The Department Director shall notify Human
Resources in writing as to whether or not the employee successfully completes their probationary
period.
e) Extension of Probationary Period - If a new, promoted, or transferred employee is performing
marginally or appears unsuited to the job, the Department Director should discuss the situation
with the HR Director before the expiration of the probationary period. The probationary period
may be extended initially for up to ninety (90) additional calendar days with the approval of the
HR Director. An additional ninety day extension may be granted at the request of the Department
Director in writing prior to the end of the original ninety (90) day period, specifying the reason for
the request. The employee must be advised of each extension and the reason(s) for it.
Section 800.021 New Employee Orientation
All new hires are required to attend a mandatory (2) day New Employee Orientation class prior to
reporting to their department. New employee orientation is conducted the first Monday of a pay period at
the designated location. The first day of this program begins at 8:00 AM and concludes at approximately
5:00 PM. The second day will begin at 9:00 AM and conclude at approximately 12:00 PM. HR will
notify new employees of the date that they will be attending orientation and will provide directions, if
needed.
Attachment number 2
Page 141 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 142 | P a g e
Formatted: Centered
The Human Resources Department tracks orientation attendance. Departments will be notified by a
memorandum from the HR Director if employees fail to complete the orientation in the time frame
indicated.
Section 800.022 Immigration Law Compliance
Augusta, Georgia is committed to employing only United States citizens and aliens who are authorized to
work in the United States and does not unlawfully discriminate on the basis of citizenship or national
origin.
In compliance with the Immigration Reform and Control Act of 1986, each new employee, as a condition
of employment, must complete the Employment Eligibility Verification Form I-9 and present
documentation establishing identity and employment eligibility. Within three days of the new hire
employment date, and upon completion of Form I-9, Human Resources will submit a request through the
E-Verify Employment Eligibility Verification system. Human Resources will immediately receive notice
if the employee has received 1) Employment Authorization, 2) SSA Tentative Non-confirmation, or 3)
DHS Verification in Process notice. The State of Georgia, in conjunction with Homeland Security,
implemented this employment eligibility requirement July, 2007.
Employees with questions or seeking more information on immigration law issues are encouraged to
contact the Employment Manager. Employees may raise questions or complaints about immigration law
compliance without fear of reprisal.
Section 800.023 Conflicts of Interest
Employees have an obligation to conduct business within guidelines that prohibit actual or potential
conflicts of interest. This policy establishes only the framework within which Augusta, Georgia wishes
the business to operate. The purpose of these guidelines is to provide general direction so that employees
can seek further clarification on issues related to the subject of acceptable standards of operation. Contact
the Human Resources Director for more information or questions about conflicts of interest.
An actual or potential conflict of interest occurs when an employee is in a position to influence a decision
that may result in a personal gain for that employee or for a relative as a result of Augusta, Georgia's
business dealings. For the purposes of this policy, a relative is any person who is related by blood or
marriage, or whose relationship with the employee is similar to that of persons who are related by blood
or marriage.
Transactions with outside firms must be conducted within a framework established and controlled by the
executive level of Augusta, Georgia. Business dealings with outside firms should not result in unusual
gains for those firms. Unusual gain refers to bribes, product bonuses, special fringe benefits, unusual price
breaks/increases, and other windfalls designed to ultimately benefit the employer, the employee, or both.
Promotional plans that could be interpreted to involve unusual gain require specific executive-level
approval.
No "presumption of guilt" is created by the mere existence of a relationship with outside firms. However,
if employees have any influence on transactions involving purchases, contracts, or leases, it is imperative
that they disclose to an officer of Augusta, Georgia as soon as possible the existence of any actual or
potential conflict of interest so that safeguards can be established to protect all parties.
Attachment number 2
Page 142 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 143 | P a g e
Formatted: Centered
Personal gain may result not only in cases where an employee or relative has a significant ownership in a
firm with which Augusta, Georgia does business, but also when an employee or relative receives any
kickback, bribe, substantial gift, or special consideration as a result of any transaction or business dealings
involving Augusta, Georgia.
Section 800.024 Outside Employment
An employee may hold a job with another organization as long as he or she satisfactorily performs his or
her job responsibilities with Augusta, Georgia. All employees will be judged by the same performance
standards and will be subject to Augusta, Georgia's scheduling demands, regardless of any existing
outside work requirements.
$OORXWVLGHHPSOR\PHQWPXVWEHDSSURYHGLQDGYDQFHE\WKHUHTXHVWLQJHPSOR\HH¶V'HSDUWPHQW'LUHFWRU
or Administrator. The request must include a description of the business for which the employee plans to
work and the hours the employee plans to work.
If Augusta, Georgia determines that an employee's outside work interferes with performance or the ability
to meet the requirements of Augusta, Georgia, as they are modified from time to time, the employee may
be asked to terminate the outside employment if he or she wishes to remain employed with Georgia
Augusta, Georgia. ,IWKHHPSOR\HH¶VSHUIRUPDQFHGRHVQRWLPSURYHDQGRUWKHHPSOR\HHUHIXVHVWRFHDVe
performing outside employment, the employee may be subject to discipline up to and including
termination. Outside employment will present a conflict of interest if it has an adverse impact on
Augusta, Georgia. Outside employment shall not occur during WKH HPSOR\HH¶V UHJXODU RU DVVLJQHG
working hours unless the employee is either on vacation or compensatory leave.
Section 800.025 Political Activities
A. Prohibited Activities during Working Hours. An Employee shall be subject to discipline up to and
including immediate dismissal for violation of these provisions ±
1) No Employee of Augusta, Georgia shall, while on duty -
a) Request or solicit contributions or anything of value for any political candidate or cause;
b) participate in any political campaign by speaking in favor of any candidate or cause;
c) distribute literature;
d) picket or demonstrate on behalf of or in opposition to any political candidate or cause;
e) make telephone calls in support of any candidate or cause; or
f) organize, plan, or in any other way participate in the administration or carrying on of any
political campaign.
2) No employee or volunteer of Augusta, Georgia shall, while on duty, while in the uniform of
Augusta, Georgia, or while in or operating any Augusta, Georgia vehicle display any badge,
button, sign or sticker promoting or opposing any political cause or candidate.
3) No employee of Augusta, Georgia shall use public funds, property, or any other instrumentality or
thing of value belonging to Augusta, Georgia to promote or oppose any political cause or
candidate.
4) Nothing in this policy shall be interpreted to prohibit an Employee ±
Attachment number 2
Page 143 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 144 | P a g e
Formatted: Centered
a) From stating any opinion regarding any political issue or cause in ordinary conversation during
working hours providing that such a conversation does not interfere with the Employee's
assigned job duties and is not repeated numerous times so as to become campaigning rather
than casual ordinary conversation.
b) From supporting any political cause or candidate during non-working hours.
B. Coercion/Intimidation of Public Employees. No officer or employee of Augusta, Georgia shall use
his or her public office or employment for the purpose of or with the effect of ±
1. Coercing or intimidating any Augusta, Georgia employee with respect to contributing to,
opposing, promoting, or refraining from contributing to, opposing or promoting any political
cause of or candidate.
2. Obtaining a benefit as a result of any political activity by intentionally committing an
unauthorized act under color of law or intentionally refraining from performing a duty
imposed upon him or her by law.
C. Illegal Political Activities. No officer or employee of Augusta, Georgia shall engage in any political
activity that is prohibited under federal or state law. Any person engaging in such an activity shall be
subject to disciplinary action, up to and including dismissal. The following list of activities is not
exhaustive and is included for illustrative purposes only. Any illegal activity which is prohibited by
federal or state law but which fails to appear on this list is hereby incorporated by reference. No
officer or employee shall -
1. Engage in any of the following activities within 150 feet of a polling place:
a) Electioneering;
b) Circulating cards or handbills;
c) Soliciting signatures;
d) Interfering with voting or the administration of the polling place; or
e) Conducting an exit or public opinion poll.
2. Obstruct or prevent access to a polling place.
3. Remove a ballot from a polling place or solicit a voter to show his or her ballot.
4. Attempt to intimidate, influence, or bribe a voter by menace, force, threat, or corrupt means.
5. Directly or indirectly offer a bribe or reward to induce a voter to vote for or against a person or
proposition.
6. Attempt to influence a voter to vote or not to vote, directly or indirectly, by menace or corrupt
means.
7. Hinder, disturb, persuade, threaten, or intimidate any person from giving his or her vote.
8. Knowingly and willfully make a false assertion or propagate a false report concerning a
candidate which has a tendency to prevent his or her election.
Attachment number 2
Page 144 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 145 | P a g e
Formatted: Centered
D. Conflicts of Interest. If any Augusta, Georgia employee seeks or accepts appointment or election to
any public office that when the seeking or holding of such office would be incompatible or would
substantially interfere with the discharge of his or her duties as an Employee of Augusta, Georgia,
such employee shall request a leave of absence without pay while seeking such office and resign
employment with Augusta, Georgia if such office is obtained.
Section 800.026 Employee Separation and Termination
Types of Termination
1) Job Abandonment. An Employee not on an authorized leave of absence who, without valid reason,
fails to report for work for three (3) consecutive days will be considered to have voluntarily resigned
from the service of Augusta, Georgia.
2) Voluntary Resignation. A voluntary resignation for any reason other than formal retirement. An
Employee wanting to leave August, Georgia in good standing shall provide a written resignation to his
or her immediate supervisor at least fourteen (14) calendar days prior to the effective date of
resignation. The resignation letter should include the reason for leaving as well as the proposed
eIIHFWLYHGDWH7ZRZHHNV¶QRWLFHLVXQGHUVWRRGWRPHDQWKDWWKHUHVLJQLQJ(PSOR\HHZLOOEHDYDLODEOH
for work during this time. Exceptions to the time limit requirement may be granted by the Department
Director.
3) Involuntary discharge or dismissal. Termination of a regular employee by Augusta, Georgia for just
cause and shall be governed by the provisions of these policies and procedures as hereinafter set forth.
4) Probationary Termination. Discharge of an employee for any reason or no reason so long as such
discharge does not violate any federal or state law during the established probationary period.
5) Layoff/Reduction in Force (RIF). Involuntary separation of an employee by Augusta, Georgia for
shortage of funds or work, abolishment of the position, material changes in the duties or organization,
or related reasons beyond the ePSOR\HH¶VFRQWUROZKLFK do not reflect dissatisfaction with the service
of the employee. The duties previously performed by any laid-off employee may be reassigned to
other employees holding positions in appropriate classes.
6) Loss of Job Requirements. Any employee who fails to obtain or ceases to hold a special license or
other special requirement necessary to perform the job he/she performs or is intended to perform shall
be laid off until such license or special requirement is obtained. The license or special requirement
shall be obtained within the specified period of time designated by the ePSOR\HH¶V 'HSDUWPHQW
Director or the employee shall be dismissed.
7) Disability Retirement. An employee will notify his or her immediate Supervisor of resignation due to
disability. A disability is an inability to perform the functions of a job due to injury, illness, disease, or
a medical condition that makes the ePSOR\HH¶VFRQWLQXDQFHRQthe job a danger to himself/herself or
to others. Medical documentation from a licensed doctor or medical facility stating the Employee is
totally disabled to perform his or her job must be provided by the retiring employee to the Human
Resources Department.
Attachment number 2
Page 145 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 146 | P a g e
Formatted: Centered
8) Retirement. Any Employee may retire by voluntarily separating employment with Augusta, Georgia
coupled with a statement by the Employee that he/she is retiring in accordance with their retirement
plan.
Section 800.027 Layoff/Reduction in Force (RIF)
Employee Selection
Any involuntary separation not related to an employee's conduct shall constitute a lay-off or reduction in
force (RIF).
1) Reasons for Layoff - Any employee may be laid off because of shortage of funds or work,
abolishment of the position, material changes in the employee's job duties or organization of the
employee's department, economic conditions or related reasons beyond the employer's or the
employee's control which do not reflect dissatisfaction with the service of the Employee. The duties
previously performed by any laid-off employee may be reassigned to other employees holding
positions in appropriate classes.
2) Notice to Department Director - Whenever the lay-off of any employee shall become necessary, the
Augusta, Georgia Commission shall direct the Administrator to and the Administrator shall notify the
Department Director at least sixty (60) calendar days in advance of the intended action of the
necessity for such lay-off and the reasons therefore. The Department Director shall there upon furnish
to the Director of Human Resources the names and job titles of the employees to be laid off, the
reason each person was selected, and the order in which such layoff shall be effected.
3) Order of Layoff - Should it become necessary to reduce the number of employees within a given class
in any department, such employees shall be laid off on the basis of the following three factors to be
weighted equally - length of service in class, length of service with the government, and performance
evaluations for the last three years.
4) Special Cases - Should a Department Director determine that the retention of a certain employee is
essential to the effective operation of the department because of the fact that such employee possesses
special skills or ability, and should the Department Director wish to retain such employee in
preference to another with a higher rating, then the Department Director shall submit a written request
to the Director of Human Resources. Such notification shall set forth in detail the specific skills and
abilities possessed by the employee and the reasons why such employee is essential to the effective
operation of the department. With the approval of the Administrator, the individual may be retained.
5) Notice to Employees - Regular employees to be laid off shall be notified in writing by the Director of
Human Resources at 60 calendar days prior to the effective date of the layoff.
Layoff Status
Employees shall be recalled in the reverse order of their layoff, but they shall retain their eligibility to be
placed on the Reemployment Priority List (RPL) for that class in their former department or for higher
classes. Employees who are on layoff, if assigned to the same or a higher class than that class previously
held, shall lose all recall rights to the position vacated because of the layoff and shall have their names
removed from the Reemployment Priority List if they refuse to accept an offered position.
Attachment number 2
Page 146 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 147 | P a g e
Formatted: Centered
Recall
Employees laid off or demoted because of a layoff shall be recalled from layoff or demotion from the
RPL for which they have qualified on the basis of their seniority when positions in those classes become
available. However, such recall rights shall not extend beyond two (2) years from the effective date of
layoff or demotion. If employees refuse to accept those positions affected, they shall lose all rights to
those positions. An employee not re-employed within two (2) year from the effective date of such layoff
shall lose all recall rights.
Bridging of Service
For any layoff not exceeding a one (1) year period, those regular employees will be given an adjusted
service computation date (SCD) to adjust for the period of layoff upon their reinstatement.
Section 800.028 Employee Exit Interview
Prior to the last day of employment, the Supervisor or employee should schedule an appointment to
conduct an exit interview with the Human Resources Department prior to the last day of employment.
Temporary employees do not participate in the Exit Interview process unless information can be gained
which will improve or enhance present employment conditions.
1) The Exit Interview shall be maintained separately from the Employee's official personnel file.
2) The Human Resources Department is notified of the Employee's separation date via department
memo or Employee letter of resignation.
3) Employees shall receive pay for work performed through the last hour worked and for unused
benefits as stipulated by policy and laws governing such payments.
4) Termination pay shall be reduced by any authorized legal deductions, credit union, United Way,
and any other amounts specifically agreed upon orally or in writing by the Employee and Augusta,
Georgia.
5) All Augusta, Georgia property must be returned before the final paycheck is given to the
Employee. The terminating Employee is responsible for ensuring all paperwork has been
completed. Failure by the terminating Employee to properly exit may result in delay of receipt of
the final paycheck.
6) The official date of termination will be the last full day the Employee reports for work.
7) Benefits continue according to the benefits deduction schedule. A benefits representative will
discuss options to continue medical, life, dental and supplemental products after termination of
employment.
8) Forms to request Retirement or Deferred Compensation refunds, if any, are available in the
Human Resources Department or on vendor website.
9) All claims for unemployment compensation as filed by a terminating Employee shall be processed
by the Human Resources Department. Requests for information about unemployment
Attachment number 2
Page 147 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 148 | P a g e
Formatted: Centered
compensation should be forwarded to the Human Resources Department immediately to avoid
unauthorized charges against Augusta, Georgia's account.
Section 800.029 Personal Information and Personnel Records
Confidentiality - Subject to the provisions of the Georgia Open Records Act (O.C.G.A.50-18-70) and
other federal and laws, employee personnel records covered under these policies and procedures and all
other records and materials relating to the administration of the personnel system shall be considered
confidential and the property of Augusta, Georgia. Information that is obtained in the course of official
duties shall not be released by an employee charged with this responsibility as part of official duties
except as required by law.
Personnel Transactions - All appointments, separations, and other personnel transactions shall be
recorded on forms provided by the Human Resources Department. A separate file folder shall be
prepared and maintained for each employee and shall contain the original or a copy of all pertinent
documents. All medical information shall be maintained separately from the employee personnel files
and kept confidential.
Public Inspection - All personnel records shall be subject to public inspections as required by the
Georgia Open Records Act and other federal and state laws. The following information relative to
employees and former employees shall be accessible to the Human Resources Director, the Board of
Commissioners, the Department Director(s) and supervisor(s) concerned, the Civil Service Commission,
and the employee involved: classification or job title and salary; selection records; and performance rating
reports. Other personnel information may be made available for official purposes at the discretion of the
Human Resources Director.
Destruction of Records - Employee service records shall be kept in accordance with federal and state
laws and regulations regarding retention schedules after termination of employment.
Attendance Records - Regular attendance reports shall be prepared and submitted by each Department
Director as required by the Director of Human Resources and in the form designate by the Director of
Human Resources.
Section 800.030 Access to Personnel Files
Augusta, Georgia maintains a personnel file on each employee. The personnel file includes such
information as the employee's job application, resume, records of training, documentation of performance
appraisals, salary increases, and other employment records.
Personnel files are the property of Augusta, Georgia, and access to the information they contain is
restricted. Generally, only supervisors and management personnel of Augusta, Georgia who have a
legitimate reason to review information in a file are allowed to do so.
Employees who wish to review their own file should contact the Human Resources Department. With
reasonable advance notice, employees may review their own personnel files in the Human Resources
Department and in the presence of an individual appointed by Human Resources to maintain the files.
Attachment number 2
Page 148 of 269
Item # 11
Attachment number 2
Page 149 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 150 | P a g e
Formatted: Centered
Supervisory personnel investigating impropriety or misconduct by employees, investigators employed by
Augusta, Georgia Commission, or investigative agents of other organizations and agencies specifically
approved and commissioned to undertake and internal investigation of any Augusta, Georgia operated or
funded activity, are authorized to employ polygraph examinations. Polygraph examinations may be
administered to as few or as many employees as deemed necessary by the investigating personnel.
Polygraph examinations may be administered only by persons employed as polygraph examiners by a law
enforcement agency or by persons licensed by the Georgia Board of Polygraph Examiners or licensed in
some other state to conduct such examinations. The questions asked in any polygraph examination must
relate narrowly and directly to the subject's participation in the alleged impropriety or misconduct under
investigation or to his or her knowledge of information pertaining to such impropriety or misconduct.
Refusal of an order to submit to a polygraph examination under the circumstances covered in this policy
shall be considered to be refusal to follow a direct order and shall constitute cause for initiation of adverse
action based upon insubordination.
Section 800.035 Workplace Violence
Augusta, Georgia is committed to providing a safe environment for working and conducting business.
Augusta, Georgia will not tolerate acts of violence committed by Augusta, Georgia employees or
members of the public on Augusta, Georgia property or between Augusta, Georgia employees whether or
not on Augusta, Georgia property. Any unlawful violent actions committed by employees or members of
the public while on Augusta, Georgia property or while using Augusta, Georgia facilities will be
prosecuted as appropriate. Augusta, Georgia intends to use reasonable legal, administrative, and
disciplinary procedures to secure the workplace from violence and to reasonably protect employees and
members of the public.
Augusta, Georgia remains committed to maintaining a work environment that is free of violence or
intimidation. In keeping with this strong commitment, Augusta, Georgia will not tolerate any violence or
threats against employees by anyone, including any supervisors, coworkers, vendors, clients, customers,
or visitors.
THREATS OR ACTS OF VIOLENCE
"Threats or acts of violence" include (but are not limited to) behavior or actions that a reasonable person
would perceive as a threat against oneself, another person, or property. Actions or behavior that are
sufficiently severe, offensive, or intimidating and/or alters employment conditions will be subject to
discipline up to and including termination.
PROCEDURES FOR DEALING WITH THREATS OR ACTS OF VIOLENCE IN THE
WORKPLACE
When a threat or violent act occurs:
1. If the situation constitutes an emergency, CALL 911. If the situation constitutes an emergency and
occurs in the Municipal Building, call the Marshal's Department at 821-2368. After 911 or the
Marshal's Department has been contacted, contact an immediate supervisor and the Risk
Management Manager at 821-2486.
Attachment number 2
Page 150 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 151 | P a g e
Formatted: Centered
2. If the situation does not constitute an emergency, contact your immediate supervisor, the
appropriate Department Director, and the Risk Management Manager.
All reports of threats or violence will be evaluated immediately and appropriate action will be taken in
order to protect the employee from further violence. Appropriate disciplinary action will be taken when it
is determined that an Augusta, Georgia employee has committed an act of violence. Where Augusta,
Georgia employees exhibit such behavior, Augusta, Georgia reserves the right, under the direction of the
Director of Human Resources or the Risk Management Manager, to determine fitness for duty.
[Employees may be suspended with or without pay pending this fitness for duty evaluation.] Where issues
of employee safety are of concern, Department Directors and supervisors should evaluate the workplace
and make appropriate recommendations regarding a reasonable response. Additionally, supervisors are
encouraged to consult with the Risk Management Manager and/or Employee Assistance Program about
appropriate resolution of instances of workplace violence. Each employee of Augusta, Georgia and every
person on Augusta, Georgia's property are encouraged to report threats or acts of physical violence of
which he/she is aware.
Workplace violence shall constitute a violation of Augusta, Georgia policies and procedures handbook.
Violation by an employee of any provision of this policy may lead to disciplinary action (up to and
including termination).
Section 800.036 Cellular Phones
A. Devices covered by this policy include cell phones, Blackberries, mobile phones, text pagers, two-
way radios, and other wireless devices, whether owned by Augusta, Georgia or an employee
FROOHFWLYHO\UHIHUUHGWRDV³'HYLFHV´
B. During working hours, employees may not inappropriately use any Device for any inappropriate
purpose, including, but not limited to:
1. Engaging in personal conversations;
2. Playing games;
3. Checking personal e-mail; and
4. Sending or receiving personal text messages.
C. Emplo\HHVPD\XVHSHUVRQDO'HYLFHVGXULQJEUHDNVOXQFKSHULRGVRUZKLOHRWKHUZLVHRQDQ³RII
GXW\´VWDWXVRQO\3HUVRQDOFHOOSKRQHRUWH[WXVDJHZLOORQO\EHDOORZHGGXULQJZRUNLQJKRXUVIRU
bona fide personal and/or family medical emergencies. Personal cell phones may be used for XUJHQW³ZRUNUHODWHG´HYHQWVZKHUHWKHXVHRIDODQGOLQHWHOHSKRQHLVQRWSRVVLEOHRUSUDFWLFDO
D. The use of any camera or Device by an employee while on duty that may capture visual images
without prior approval and specific written authorization of their immediate supervisor is
prohibited.
E. 1R HPSOR\HH LV DOORZHG WR ZHDU D SHUVRQDO ³KDQGV IUHH FHOO KHDG-SKRQH´ LQFOXGLQJ EXW QRW
limited to, Bluetooth devices, while on duty unless otherwise granted prior written approval from
their immediate supervisor.
F. The use of departmental issued Devices is authorized for official business and may be worn, as
appropriate, on your person.
Attachment number 2
Page 151 of 269
Item # 11
Attachment number 2
Page 152 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 153 | P a g e
Formatted: Centered
Related Polices and Resources
Work-Related Injuries or Illness
All matters relating to job-related illness or injury must be referred to the Risk Management office. This
includes, but is not limited to, benefits eligibility, medical certifications, the length of leave, return to
work, and accommodation for return to work.
Section 800.038 Fitness-For-Duty Procedures
,IE\REVHUYDWLRQRIDQHPSOR\HH¶VEHKDYLRURUE\UHFHLSWRIUHOLDEOHLQIRUPDWLRQ$XJXVWD*HRUJLDKDV
reason to believe that an employee may lack the ability to perform the essential functions of his or her
position due to a physical or mental condition, the following steps will be taken:
1. The supervisor or other appropriate department personnel will provide Human Resources with
detailed information regarding the reason for and circumstances leading up to the fitness-for-duty UHIHUUDOLQFOXGLQJLQIRUPDWLRQRQHVVHQWLDOMREIXQFWLRQVHYLGHQFHRIWKHHPSOR\HH¶VLQDELOLW\WR
perform those functions effectively, and any attempts at resolving the matter.
2. The Director of Human Resources (or his/her designee) will review the information provided in WKH UHIHUUDO DORQJ ZLWK D FXUUHQWMRE GHVFULSWLRQRI WKH HVVHQWLDO IXQFWLRQVRI WKH HPSOR\HH¶V
position. If it is determined that a fitness-for-duty evaluation is necessary, the Director or
designee will send the employee a letter indicating the need for a fitness-for-duty evaluation, the
fitness-for-duty evaluation form, the current job description, and authorization for release patient
medical information.
3. Human Resources will determine the independent, third-party, licensed health care professional
ZKRZLOOSHUIRUPWKHHYDOXDWLRQZKLFKPD\EHWKHHPSOR\HH¶VSHUVRQDOKHDOWKFDUHSURIHVVLRQDO
4. )DLOXUH RQ WKH HPSOR\HH¶V SDUW WR FRPSO\ ZLWK D VFKHGXOHG ILWQHVV-for-duty evaluation may
constitute insubordination and be cause for disciplinary action, up to and including termination.
5. ,I+XPDQ5HVRXUFHVSLFNVDKHDOWKFDUHSURIHVVLRQDORWKHUWKDQWKHHPSOR\HH¶VSHUVRQDOKHDOWK
care professional, all costs of the health care services performed by the health care professional as
part of the evaluation will be paid by Human Resources.
6. If Human Resources deems it necessary, the employee may be placed on temporary, paid
Administrative Leave until the evaluation is completed.
7. The employee will be requested to sign a voluntary written authorization allowing the health care
professional to provide certain information obtained through the evaluation to Augusta, Georgia.
If no authorization is executed, Augusta, Georgia may nevertheless obtain a description of the
functioQDO OLPLWDWLRQV RI WKH HPSOR\HH WKDW PD\ OLPLW WKH HPSOR\HH¶V DELOLW\ WR SHUIRUP WKH
essential functions of his or her position, but no statement of medical cause may be disclosed.
8. Insofar as feasible, the results of the evaluation will be treated as confidential, kept in a separate
file within Human Resources, and the minimum necessary information will be shared only with
those who need to know the results for legitimate business purposes.
9. If it is determined that the employee is not able to perform the essential functions of his or her
position, Human Resources will attempt to determine if there is a reasonable accommodation that
will allow the employee to continue working. If an appropriate accommodation cannot be made,
other options will be identified and communicated to the employee.
10. ,ILWDSSHDUVWKDWDQ\IXQFWLRQDOOLPLWDWLRQVRQWKHHPSOR\HH¶VDELOLW\WRSHUIRUPWKHHVVHQWLDO
functions of his or her position are the result of a work-related injury, the matter will be referred to
Risk Management for tKHSURFHVVLQJRIDZRUNHUV¶FRPSHQVDWLRQFODLP
11. All action taken in carrying out this policy and these procedures will comply with federal and state
laws, as well as Augusta, Georgia policies and procedures and applicable contract provisions.
Attachment number 2
Page 153 of 269
Item # 11
Attachment number 2
Page 154 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 155 | P a g e
Formatted: Centered
department without violating the nepotism policy. If this is not possible, then within sixty (60) days of
the commencement of the relationship, the Director of Human Resources will evaluate the qualifications
of the affected employee who was last hired to see if there is a comparable position available in another
department. If no comparable position is found in another department within sixty (60) days of the
commencement of the relationship, or if a transfer is offered and declined by the employee, all continued
rights of employment shall cease, and such employee will be separated.
Employees who are aware of an unreported workplace relationship that violates this policy shall report
such relationship to the Human Resources Department.
All employees should also remember that Augusta, Georgia maintains a strict policy against unlawful
harassment of any kind, including sexual harassment. Augusta, Georgia will vigorously enforce this
policy consistently with all applicable federal, state, and local laws.
Section 800.040 Elected Officials and Their Employees
While applicants to positions under the jurisdiction of Augusta, Georgia elected officials and employees
of Augusta, Georgia elected officials are not specifically covered under this Manual, unless such elected
official has opted to the Manual on the Election Form by an Elected Official contained herein, they are
covered by any applicable federal and state laws, including those governing equal opportunity and non-
discrimination. If any applicant or employee of an Augusta, Georgia elected official desires to determine
whether a particular elected official has opted into this Manual, they may do so by contacting the
Augusta, Georgia Human Resources Department.
Attachment number 2
Page 155 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 156 | P a g e
Formatted: Centered
CHAPTER IV.
SUBSTANCE ABUSE
A. GENERAL
Section 900.001 Policy and Purpose
A. In recognition of the continued and growing problem of substance abuse, it is the policy of the
Augusta, Georgia to take all reasonable measures to assure that drug and/or alcohol use by
employees does not jeopardize the safety of its operations or otherwise adversely affect Augusta,
Georgia employees, the community, or the public's trust in its ability to carry out its responsibilities.
B. Augusta, Georgia FDQQRWDQGZLOOQRWWROHUDWHODSVHVLQHPSOR\HH¶VDELOLW\WRRSHUDWHVDIHO\DQG
productively. The policy of Augusta, Georgia is that if an employee required under this Policy to
be tested for substance abuse either refuses or fails such test, the employee will be subject to
disciplinary measures up to and including termination.
C. 7KHHPSOR\HHV¶FRRSHUDWLRQZLWKDQGDGKHUHQFHWRWKHAugusta, Georgia¶VSROLFLHVDQGSURFHGXUHV
regarding substance abuse are conditions of their continued employment. If an employee violates or
is insubordinate by refusing to cooperate with any of these policies and procedures, the employee is
subject to disciplinary measures up to and including termination.
D. This Chapter contains the Augusta, Georgia Substance Abuse Policy. The use of the term
"Augusta", in this document, refers to the Augusta, Georgia government. Augusta, Georgia will
make a public announcement of this Policy. Employee training will be undertaken to ensure that
each individual employee understands the Policy's requirements and his or her obligation to
cooperate fully in the testing program.
E. All references within this Policy to regulations, processes and procedures are available to any
employee for review in the Risk Management Office located in Room 217, Municipal Building, 530
Greene Street, Augusta, Georgia 30911.
F. Augusta, Georgia reserves the right to amend this Policy at any time, in its sole discretion, with 60
days' written notice to employees before implementation of the amendment(s).
G. PRESCRIPT NOTE: Federal law requires testing of certain employees within transit systems and
holders of Commercial Drivers Licenses (49 CFR Parts 40 & 655). The testing requirements and
procedures for these employees may be different than for employees tested under authority of
Augusta, Georgia. Where a requirement of this Policy differs as to regular and transit or CDL
employees, such difference will be noted. From time to time Federal and State will update/revise
their respective regulations. When such updates/revisions occur they will automatically become a
part of this policy when they become Final Rule.
Section 900.002 Policy Intent
It is the intent of this policy to:
A. Provide for a drug-free workplace;
Attachment number 2
Page 156 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 157 | P a g e
Formatted: Centered
B. Provide for the safety of employees, the department and the public;
C. Detect and deter the misuse of drugs and alcohol by employees of Augusta, Georgia; and
D. Comply with Federal, State and local regulations, policies or authority regarding substance abuse
testing of employees.
Section 900.003 References
A. Federal Register. 49 CFR Part 40 (as amended): Procedures for Transportation Workplace Drug and
Alcohol Testing Programs (Final Rule);
B. Federal Register. 49 CFR Part 655 (amended 8/2001) (replaces 653/654): Prevention of Alcohol
Misuse and Prohibited Drug Use in Transit Operations;
C. The Drug-Free Workplace Act, 1988 (PL 100-690);
D. Georgia Code Title 50, Chapter 24, Drug-Free Workplace;
E. Federal Register, 49 CFR Part 382 (as amended);
F. Controlled Substances and Alcohol Use and Testing (Federal Highway Administration, DOT).
Section 900.004 Definitions
A. Accident. For purposes of this Policy, "accident" means an occurrence or incident which results in
a post-accident drug screen as outlined in Part 2.4 herein, including:
1. For regular employees:
a. An incident involving a vehicle that has resulted in damage to property or physical injury
to a person(s). This Section includes Transit employees and CDL Holders under the
authority of Augusta, Georgia; and/or
b. An occurrence or incident which results in the employee seeking, requiring and/or
receiving medical treatment for injuries suffered in connection with the occurrence or
incident. This Section includes Transit employees and CDL holders under the authority
of Augusta, Georgia.
2. For Transit Employees and CDL Holders:
a. A vehicular accident which results in a fatality;
b. A vehicular accident which results in the Transit Employee or CDL Holder receiving a
moving traffic citation under State or local law;
c. A vehicular accident where one or more of the vehicles involved receive disabling
damage and cannot be moved from the scene under its own power (including a single-
vehicle accident). For the purposes of this definition, disabling damage means damage
which precludes departure of the vehicle from the scene of the occurrence in its usual
manner in daylight after simple repairs. Disabling damage includes damage to vehicles
that could have been operated but would have been further damaged if so operated, but
does not include damage which can be remedied temporarily at the scene of the
occurrence without special tools or parts, tire disablement without other damage even if
no spare tire is available, or damage to headlights, taillights, turn signals, horn, mirrors
or windshield wipers that make them inoperative;
d. (URBAN Transit Employees): A vehicular accident in which the performance of the
Transit Employee or CDL Holder could have contributed to the accident, as determined
by management using the best information on hand at the time of the determination;
and/or
e. A vehicular accident in which any individual suffers a bodily injury and is immediately
transported away from the scene of the accident for medical treatment.
Attachment number 2
Page 157 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 158 | P a g e
Formatted: Centered
B. Adulterated specimen. A specimen that contains a substance that is not expected to be present in
human urine, or contains a substance expected to be present but is at a concentration so high that it is
not consistent with human urine.
C. Alcohol. The intoxicating agent in beverage alcohol, ethyl alcohol, or other low molecular weight
alcohols contained in any beverage, mixture, mouthwash, candy, food, preparation or medication.
D. Canceled Test. A drug test that has been declared invalid by a Medical Review Officer. A canceled
test is neither a positive nor a negative.
E. Contractor. A person or organization(s) providing a service for Augusta, Georgia or its subordinate
departments, divisions, sections or agencies under a specific understanding or arrangement. The
understanding can be a written contract or an informal arrangement that reflects an ongoing
relationship between the parties.
F. Controlled Substances. For the purposes of this Policy, see definition of "Drugs" below.
G. Designated Employer Representative (DER). An employee authorized by the employer to take
immediate action to remove employees from safety-sensitive duties and to make required decisions
in drug testing. The DER also receives drug test results and other communications for the employer.
For the purpose of this policy, the Designated Employer Representative (DER) is the Risk
Management Manger, Sandra Wright. In the absence of the Risk Management Manager, it shall be
the Risk Management Loss Control Officer, Joe Crozier. This also meets the requirements of 49
CFR Parts 40 and 655.
H. Department of Transportation (DOT): Department of the federal government which includes the,
Federal Transit Administration, Federal Railroad Administration, Federal Highway Administration, )HGHUDO0RWRU&DUULHU¶V6DIHW\$GPLQLVWUDWLRQFederal Aviation Association and Special Programs,
and the Office of the Secretary of Transportation.
I. Direct Observation Collection: Procedure is the same as a routine collection procedure with the
additional requirement that an observer of the same gender as the individual physically watches
the employee urinate into the collection container.(DOT rule change 2008).
J. Dilute Specimen: A specimen with creatine and specific gravity values that are lower than expected
for human urine.
K. Drugs. For the purposes of this Policy, "Drugs" include illegal street drugs, legal drugs either taken
for non-medical reasons or without a valid prescription, and alcohol. It DOES NOT include
prescription medication prescribed for the employee by a qualified health care provider and taken in
accordance with that physician's instructions. Some of the drugs which are considered controlled
substances under Federal, State or local laws include, but not limited to: marijuana, heroin, hashish,
cocaine, hallucinogens, inhalants and designer drugs, and depressants and stimulants which are not
prescribed for current personal treatment by a licensed physician.
L. Evidentiary Breath Testing Device (EBT): A Device approved by the NHTSA for the evidential
testing of breath at the 0.02 and the 0.04 alcohol concentrations.
M. Illegal Substances. For the purposes of this Policy, see definition of "Drugs" above.
N. Medical Review Officer.(MRO) A licensed physician (medical doctor or doctor of osteopathy)
responsible for reviewing laboratory results generated by the Drug Testing program, who has
knowledge of substance abuse disorders and has appropriate medical training to interpret and
evaluate an individual's positive test result together with his or her medical history and any other
relevant biomedical information; knowledge of adulteration or substituted specimens. The MRO
must also meet additional qualification training requirements which can be found in Part 40.121 of
the Federal Regulations. A test result will not be deemed positive for the purpose of disciplinary
action until ruled positive by the Medical Review Officer (MRO).
O. Negative-Dilute: A drug test which is negative for the five drug/drug metabolites but has a specific
gravity value lower than expected for human urine, second collection is required under direct
observation.
Attachment number 2
Page 158 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 159 | P a g e
Formatted: Centered
P. Safety-Sensitive Employee. Safety-sensitive employees are those who perform any of the following
tasks or duties, or have the following qualifications/job requirements:
1. Certified Law Enforcement Officers;
2. Jailers of Richmond County Sheriff's Office;
3. 911 operators/ communications officers;
4. Fire Fighters;
5. Crash Fire and Rescue employees (Bush Field);
6. Certified Correctional Officers;
7. Employees who mix chemicals with water;
8. Employees who fuel or maintain aircraft;
9. Employees who maintain airfield facilities, including aircraft ramps, taxiways or active runways
or median areas around ramps, taxiways and runways;
10. Employees whose responsibilities include airfield operations or planning activities, in areas
described in GHILQLWLRQRI³'HSDUWPHQWRI7UDQVSRUWDWLRQ´DERYH;
11. Employees who maintain, repair, or install traffic control markers, signs or devices to include
painting lane markers or directional indicators;
12. Employees of the Recreation Department, whose job responsibilities include supervising youth
(defined as "minor children"),; also those coordinating food and beverage concessions sold to
the public at events, requiring on-going compliance for health standard;
13. Operators of heavy equipment or construction type equipment, without regard to whether a CDL
license is required;
14. Employees who operate Augusta, Georgia vehicles for which a Commercial Drivers' License
(CDL) is required while performing safety-sensitive functions, as defined as:
a. While on duty, waiting to be dispatched, unless the driver has been relieved from duty by
the employer;
b. While on duty inspecting equipment as required by the Federal Motor Carrier Safety
Regulations (FMCSR's), or otherwise inspecting, servicing, or conditioning any
commercial motor vehicle at any time;
c. While on duty at the driving controls of a commercial motor vehicle;
d. While on duty, other than driving time, spent on or in a commercial motor vehicle
(except for time spent resting in the sleeper berth);
e. While on duty and loading or unloading a commercial motor vehicle, supervising, or
assisting in the loading or unloading, attending a vehicle being loaded or unloaded,
remaining in readiness to operate the vehicle, or in giving or receiving receipts for
shipments loaded or unloaded;
f. While on duty performing the driving requirements associated with an accident;
g. While on duty repairing, obtaining assistance, or remaining in attendance upon a disabled
vehicle;
15. Employees who service or repair Augusta, Georgia vehicles;
16. Control room operators, utilities department;
17. First line supervisors of anyone listed above if their job duties require they perform the listed
functions;
18. Employees of the Transit Department performing safety-sensitive functions ("Transit
Employees"). Such functions include:
a. Operation of a revenue service vehicle, including when not in revenue service;
b. Operation of a non-revenue service vehicle, when required to be operated by a holder
of Commercial Driver's license;
c. Control of dispatch or movement of a revenue service vehicle, Maintenance of revenue
service vehicles or equipment used in revenue service;
Attachment number 2
Page 159 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 160 | P a g e
Formatted: Centered
d. )LUVWOLQHVXSHUYLVRURIDQ\RQHOLVWHGDERYHDUHDOVRGHILQHGDV³7UDQVLW(PSOR\HHV´
and are subject to testing under this Policy if the position requires the employee to
perform any of the duties listed above
19. Carrying a firearm for security purposes;
20. Employees of animal control who have access to and /or administer controlled substances,
which are stored on the premise;
21. Security Officers both full-time and part-time responsible for buildings, courts and airport
security.
Q. Substance Abuse Professional (SAP): A licensed physician (medical doctor or doctor of
osteopathy) or licensed or certified psychologist, social worker, employee assistance professional,
or addiction counselor (certified by the National Association of Alcoholism and Drug Abuse
Counselors Certification Commission or by the International Certification Reciprocity
Consortium/Alcohol and other Drug Abuse) with knowledge of and clinical experience in the
diagnosis and treatment of drug and alcohol related disorders.
R. Substituted specimen: A specimen with creatine and specific gravity values that are so diminished
that they are not consistent with normal human urine.
S. Test Refusal: The following are considered a refusal to test and are treated the same as a positive
test result if the employee:
1. Fails to appear for any test (excluding pre-employment) within a reasonable time, as determined
by the employer, after being directed to do so by the employer.
2. Fails to remain at the testing site until the testing process is complete.
3. Fails to provide a urine or breath specimen for any drug or alcohol test (for FTA/DOT this
complies with Part 40 regulations).
4. In the case of a directly observed or monitored collection in a drug test, fails to permit the
observation or monitoring of your provision of a specimen.
5. Fails to provide a sufficient amount of urine or breath when directed, and it has been determined,
through a required medical evaluation, that there was no adequate medical explanation for the
failure.
6. Fails or declines to take a second test the employer or collector has directed you to take.
7. Fails to undergo a medical examination or evaluation, as directed by the MRO as part of the
verification process, RUDV GLUHFWHG E\ WKH '(5 DV SDUWRI WKH ³VK\ EODGGHU´ RU³VK\ OXQJ´
procedures.
8. Fails to cooperate with any part of the testing process (e.g. refuse to empty pockets when so
directed by the collector, behave in a confrontational way that disrupts the collection process.
9. If the MRO reports that there is a verified adulterated or substituted test result.
10. Failure or refusal to sign Step 2 of the alcohol testing form.
11. If you refuse to take a test.
Section 900.005 Prohibitions
A. The possession, unlawful manufacture, sale, distribution or presence in the body, of alcohol,
drugs, controlled substances or prescription medicine for which no valid prescription is held, in
the workplace, is strictly prohibited.
B. It is illegal and a violation of this Policy to take a medication prescribed for someone else -
prescription medicine must be prescribed for the user by a licensed physician.
C. All employees are prohibited from consuming alcohol for four (4) hours prior to reporting for duty
and for eight hours after an accident, or until he/she has been tested pursuant to this Policy. This
prohibition applies equally to Transit Employees and CDL Holders by virtue of federal regulations.
Attachment number 2
Page 160 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 161 | P a g e
Formatted: Centered
D. Any and all employees who are on an on-call work status will not consume alcohol while on-call
status.
Section 900.006 Consequences for Violations
A. The following violations will result in an employee being placed on three days administrative leave
with pay with a recommendation of termination. At such time the recommendation of termination
will be forwarded to the Human Resources Director for review. The Human Resources Director will
schedule a conference with the Administrator or his or her designee to review the recommended
termination.
1. Employees who have drug test results confirmed by the Medical Review Officer a positive for a
prohibitive substance,
2. Employees who have a confirmed alcohol content of .04 or above, while on duty, confirmed by
an evidentiary breath testing devise or blood alcohol content,
3. Employees who refuse to test under the provisions of this policy,
4. Employees who adulterate or substitute their specimens and reported by GC/MS and confirmed
by the MRO.
B. CONSEQUENCES FOR OTHER VIOLATIONS :
1. Employees whose blood alcohol content is between .02 to .039 will be removed from duty for a
minimum of 8 hours and will receive appropriate disciplinary action appropriate to the ³3URJUHVVLYHGLVFLSOLQH´SROLF\ provisions.
2. Negative Dilute when reported by the MRO will require a second test under direct observation
Section 900.007 Notification Requirements
A. If any employee is prescribed a drug whose use may affect their job performance, that employee
must immediately notify the supervisor of the prescription. For example, if an employee's
prescription drug label reads that the user should not operate a car or machinery while taking the
drug or that the drug causes drowsiness, and the employee operates a car or machinery in the course
of employment, or if the employee is a safety-sensitive employee, that employee must notify his or
her supervisor of the prescription prior to coming on duty.
B. An employee who is not on-call status, but is called during non-working hours and who have been
drinking alcohol must inform the caller that the employee have been consuming alcohol and cannot
respond to the request. No disciplinary action will be taken against the employee for not responding
due to the consumption of alcohol when the employee is not on-call.
C. Appropriate law enforcement agencies will be notified of any controlled substances found on
Augusta, Georgia property and these substances will be disposed of in accordance with policies and
procedures of the law enforcement agency called.
D. Employees must notify the department head if the employee is convicted of any Georgia Controlled
Substances Act statute in connection with activity occurring in the workplace. This notification
must be made within 5 days of the conviction.
Section 900.008 Testing Procedures
A. Drugs. Urine tests will be used for the detection of drugs and controlled substances.
1. Regular employees. Standards, procedures and processes for drug testing are available for
review at the Risk Management office.
Attachment number 2
Page 161 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 162 | P a g e
Formatted: Centered
2. Transit employees and CDL Holders. Standards, procedures and processes for testing of Transit
employees and CDL Holders are found in the federal regulations cited in Reference Section
above, and are available for review at the Risk Management Office.
3. Every urine specimen shall, at a minimum, be tested for the following illegal drug usage at levels
approved by FTA/DOT regulations in adherence to Part 40, as amended:
a. Marijuana;
b. Cocaine;
c. Opiates;
d. Phencyclidine (PCP);
e. Amphetamines.
B. Alcohol. Breath and/or blood tests will be used for the detection of alcohol
1. Regular employees. Standards, procedures and processes for alcohol tests are available for review
at the Risk Management office.
2. Transit employees and CDL Holders: Standards, procedures and processes for testing of Transit
employees and CDL Holders are found in the federal regulations cited in paragraph 1.3 above,
and are available for review at the Risk Management Office.
Section 900.009 Actions Required for Positive Tests
A. Laboratory. Once a specimen has been tested as positive on an initial screening, a confirmatory test
will be conducted prior to the laboratory's reporting the specimen as a positive result. Such test shall
be performed by GCMS method.
1. Regular Employees. Once confirmed, the laboratory will report the results with allied
documentation to the MRO, through the DER /Risk Management Office.
2. Transit Employees and CDL Holders: All laboratory reports will be sent from the laboratory
testing facility directly to the MRO.
B. Medical Review Officer. The MRO will verify all positive test results by first reviewing laboratory
reports, and confirming that a proper chain of custody (procedures to account for the integrity of
each specimen by tracking its handling and storage from point of collection to final disposition) was
followed.
1. The MRO will then contact the employee to discuss the positive result.
2. If verification of prescription drug use is required in connection with the MRO's investigation of
a positive result, the MRO shall meet personally with the employee.
3. Otherwise, the MRO may contact the employee by telephone.
4. If the MRO finds that a valid medical reason explains the positive result, the MRO will report
the test results to Risk Management as negative.
5. If the MRO is unable to find a valid medical reason for a positive result, the positive result will
be reported to the Designated Employer Representative as positive.
6. As a qualified medical professional, the MRO's medical judgment cannot be overturned by an
arbitrator, employer, or anyone else in the testing program (in accordance with Federal
Regulations - 40.149)
C. Risk Management. For all employees other than Transit Employees and CDL Holders, Risk
Management receives positive reports from the laboratory and forwards those reports to the MRO.
(Reports for Transit Employees and CDL Holders are forwarded from the laboratory directly to the
MRO, as outlined in the Medical Review Officer section above.
1. Risk Management is informed of a confirmed positive test result, by the MRO; the Risk
Manager (DER) will recommend to the appropriate department director that the employee
should be placed on three days administrative leave with pay with a recommendation of
termination from employment for a violation of this policy.
Attachment number 2
Page 162 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 163 | P a g e
Formatted: Centered
D. Department Management. Upon notification by Risk Management that an employee has tested
positive for an illegal substance or be under the influence of alcohol, department management will
immediately remove the employee from duty and initiate a letter of termination to the employee,
refer the employee to a Substance Abuse Professional and inform the employee of their right to
appeal the decision.
E. Positive Alcohol Tests
1. An employee with a confirmed blood-alcohol level of 0.04 or higher is in violation of this
Policy. Actions in Department Manager section above will apply.
2. Employees who are found to have an alcohol concentration of 0.02 or greater but less than 0.04
will not be permitted to perform the job duties until: The employee's alcohol concentration
measures less than 0.02; or the start of the employee's next regularly scheduled duty period, but
not less than eight hours following administration of the test.
Section 900.010 Split Sample Testing.
A. REQUEST FOR TESTING OF SPLIT SAMPLE. In accordance with federal and state regulations
for Transit employees, CDL holders, and Augusta, Georgia authority for all other employees, urine
drug tests shall be according to the split sample method, whereby the sample provided is divided
into two bottles. Upon being notified of a positive test result by the MRO, a Transit Employee or
CDL Holder may request that the split sample be tested. This request must be made within 72 hours
of the MRO's notification. Requests made after 72 hours will only be accepted if the delay was due
to documentable facts that were beyond the control of the employee. Testing of the split sample will
be according to federal regulations.
B. EMPLOYEE PLACED ON ADMINISTRATIVE LEAVE WITHOUT PAY: While awaiting results
of split sample, employee will not be allowed to use accrued vacation time.
C. PAYMENT FOR TESTING. An employee's economic status will not bar them from having the
split tested. If an employee cannot afford to pay for the testing up front, as a courtesy, Augusta,
Georgia will pay for this cost. Should the results from testing the split sample uphold the original
positive test result, the cost of the split test will be deducted in full from the employee's next
paycheck. If there are not enough funds in the employee's paycheck to cover the testing cost(s)
this does not relieve the employee from reimbursing Augusta, Georgia for all associated cost
incurred.
Section 900.011 Review of Termination Recommendation
The Human Resources Director or designee will schedule a grievance with the Administrator or designee to
review the departmental recommendation of termination. The Administrator or designee will either uphold
the recommendation for termination or reject the recommendation.
Section 900.012 Rehiring Terminated Employees
A. Employees being terminated for violation of this Policy will not be considered for rehire by
Augusta, Georgia for a period of one year from the date the individual successfully completes an
approved rehabilitation program (acceptable proof of completion of an approved rehabilitation
program will be required before rehiring will be considered).
B. Employees who resign after being notified of a positive test result, by the MRO or through the
administrative process, will not be considered for rehire by Augusta, Georgia, for a period of one
year from the date the individual successfully completes an approved rehabilitation program.
Attachment number 2
Page 163 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 164 | P a g e
Formatted: Centered
Acceptable proof of completion of an approved rehabilitation program will be required before
rehiring will be considered.
Section 900.013 Alcohol Testing of Transit Employees and CDL Holders
A. Federal regulations stipulate specific criteria to be applied when Transit Employees and CDL
Holders are tested for alcohol. Those regulations provide, in part, that:
1. Alcohol tests will only be conducted just before, during or just after the performance of safety
sensitive job functions.
2. Alcohol testing will be conducted if the employee is injured, from a job related activity (on-
the-job injury) and medical treatment is provided to the employee.
3. Transit employee or CDL Holder with a blood-alcohol level of .04 or higher is in violation of
federal regulations and this Policy. Such employee will be immediately removed from his or her
safety-sensitive duties and will be terminated. As part of this process the employee will be
advised of programs available for rehabilitation, if applicable.
4. Transit Employees or CDL Holder found to have an alcohol concentration of 0.02 or greater but
less than 0.04 will not be permitted to perform safety sensitive functions until: The employee's
alcohol concentration measures less than 0.02; or the start of the employee's next regularly
scheduled duty period, but not less than eight hours following administration of the test.
Section 900.014 Refusal to Submit to Testing
A. Refusal to submit a urine, breath and/or blood sample when required under this Policy will be
considered the same as a positive test result.
B. Refusal can include:
1. Fail to appear for any test (except pre-employment test) within a reasonable time, as determined
by the employer;
2. Fail to remain at the collection site until the collection process is complete;
3. Fail to provide a urine specimen for any drug test;
4. Fail to permit observation or monitoring of your provision of a specimen;
5. Fail to provide a sufficient urine specimen without a valid medical reason as verified by the
MRO;
6. Fail or decline to take a second test the employer or collector has directed you to take;
7. Fail to undergo a medical examination or evaluation, as directed by the MRO as a part of the
verification process or as directed by the DER (Designated Employer Representative);
8. Fail to cooperate with any part of the testing process (e.g. refuse to empty pockets, behave in a
confrontational way that disrupts the collection process);
9. If MRO reports a verified adulterated or substituted test result, this is considered a refusal;
10. If you refuse to take a drug test.
C. Any employee who is suspected of providing false information in connection with a test, or who is
suspected of falsifying test results through tampering, contamination, or substitution shall be
required to undergo an observed collection.
D. Confirmation of tampering, contamination, adulteration or substitution may result in
recommendation of termination from employment.
Attachment number 2
Page 164 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 165 | P a g e
Formatted: Centered
Section 900.015 Confidentiality
A. The privacy interests of employees and the legitimate interests of the Augusta, Georgia in
implementing and maintaining a substance abuse program will be accomplished by:
1. Limiting the extent of inquiries to those necessary to effectuate this Policy;
2. Assuring that disclosure of, and access to, information generated under this Policy is on a
strict need-to-know basis; and
3. Informing employees of the purpose for which the information is sought.
B. If a third party requests information (for example, in the context of a reference check), regarding
Augusta, Georgia¶VGHFLVLRQQRWWRKLUHDQDSSOLFDQWRUQRWWRWUDQVIHURUSURPRWHRUWRWHUPLQDWHDQ
employee, and that decision is based on a violation of this Policy by the applicant or employee, the
reason given for such decision will be that the applicant or employee did not comply with policy.
No further information will be given to any third party without the prior written consent of the
applicant or employee, except in the following circumstances:
1. Information may be given to Risk Management, to laboratories and to the MRO for the
purpose of administering this Policy;
2. Information may be given to the employee's department head, when a recommendation of
disciplinary action has been made and it is that department head's responsibility to carry out
such disciplinary action;
3. Information may be released to the Department of Labor and appropriate representatives of
Augusta, Georgia in the event an employee discharged for violations of this Policy applies
for and/or appeals a denial of unemployment compensation;
4. Information may be released pursuant to an order from a court of competent jurisdiction or
other tribunal;
5. Information may be released to the Equal Employment Opportunity Commission or the
Human Relations Commission if requested in connection with any inquiry or investigation
by either such body; and
6. Information may be released to those persons or bodies hearing any appeal by an employee
of any action taken pursuant to this Policy.
C. Release of Information as to Transit Employees or CDL Holder:
1. Augusta, Georgia shall release information regarding a Transit Employee or CDL Holder
record as directed by specific written consent from the employee authorizing release of the
information to an identified person.
2. Transit Employee or CDL Holder is entitled, upon written request, to obtain copies of any
records pertaining to his or her use of a prohibited substance, including any records
pertaining to test results.
3. Augusta, Georgia may disclose information that is required to be maintained to the decision
maker in a lawsuit, grievance, or other proceeding initiated by or on behalf of the employee
tested.
4. When requested by the National Transportation Safety Board as part of an accident
investigation, Augusta, Georgia shall disclose information related to its administration of
drug and alcohol tests following the accident.
5. Records shall be made available to subsequent employers upon receipt of written request
from the Employee.
6. Augusta, Georgia shall disclose data for its drug and alcohol testing program and any other
information pertaining to its anti-drug program, when requested by the Secretary of
Transportation or any Department of Transportation agency with regulatory authority over
the Augusta, Georgia transit system or Federal Highway Administration - DOT.
Attachment number 2
Page 165 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 166 | P a g e
Formatted: Centered
Section 900.016 Contractors
A. Persons engaged by Augusta, Georgia as independent contractors shall be required to comply with
Georgia's Drug-Free Workplace Act, O.C.G.A. sec. 50-24-1 et seq., before they may perform
services for Augusta, Georgia. Compliance shall be in the form of certification before beginning
services, and documentation of continuing compliance as reasonably requested by Augusta, Georgia.
B. Contractors who are also providing repair and maintenance services on DOT regulated vehicles are
required to also be in compliance with applicable provisions of the DOT/FTA drug and alcohol
testing regulations (Title 49 Part 40) if services are more than ad hoc or one time repairs. As long as
Augusta, Georgia¶VSRSXODWLRQLVOHVVWKDQWKLVGRHVQRWDSSO\WRFRQWUDFWRUVGRLQJEXVLQHVV
with Augusta, Georgia it will only apply if and when the local population exceeds 200,000.
Section 900.017 Changes to Policy
At times, State or Federal law may require that additional employees be tested for illegal substances, or
that additional or different testing mechanisms and procedures be implemented. Said State or Federal law
requirements will supersede the relevant provisions of this Policy, and this Policy may or may not be
amended to reflect those changes prior to their effective date. Affected employees will be notified in
advance of any implementation of changes as a result of State or Federal law requirements.
Section 900.018 Contact Person
The proponent agency for this Policy is the Risk Management Division of the Finance Department. Any
comments, questions or recommendations applying to this policy or testing program should be referred to
the Risk Management Manager, 530 Greene Street, Augusta, Georgia, 30911 (706) 821-2301 or FAX (706)
821-2502. Because the MRO is not an employee of Augusta, Georgia any employee wishing to contact the
MRO should contact the Risk Management Manager. The Employee Assistance Program is "CONCERN"-
EAP; located at 961 Broad Street - 722-2353 or 1-800-285-2353.
B. INDIVIDUALS SUBJECT TO TESTING
Section 900.100 Individuals Subject to Testing
Individuals will be subjected to testing as provided in the following Sections.
Section 900.101 Applicants/New Employees
All applicants who have been extended a conditional job offer will be required to undergo the following as
part of the employment process:
A. Regular New Hires
1. Submit to a substance abuse test for illegal substances prior to becoming an employee of
Augusta, Georgia. Such screening must be completed within 24 hours of the time the applicant
is instructed to submit to the screening. Any screening not completed within that 24 hour period
will not be accepted
2. Sign a Substance Abuse Coverage Form (Form SA-1) within 45 days of the first day of work.
This form states that the applicant has read, understands and agrees that he/she is subject to this
Policy as a condition of employment with Augusta, Georgia. The signed form will be retained in
the employee's personnel file.
Attachment number 2
Page 166 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 167 | P a g e
Formatted: Centered
3. Sign a Test Consent Form (Form SA-3). This form authorizes Augusta, Georgia and/or its
representatives to perform the appropriate tests to identify the presence of drugs or controlled
substances and releases test results as necessary to administer this Policy. The signed form will
be forwarded to Risk Management where it will be retained in the employee's drug test file.
a. Refusal of an applicant to sign SA-3 will remove the applicant from consideration for
employment with Augusta, Georgia since the employment process cannot be completed.
B. Transit Applicant or New Hire and Holders of Commercial Driver's License
1. Submit to a pre-employment substance abuse screening for illegal substances prior to becoming
an employee of Augusta, Georgia. Such screening must be completed prior to performing any
safety sensitive function.
2. Sign a Substance Abuse Coverage Form (Form SA-2) within 45 days of the first day of work,
which form states that the applicant has read, understands and agrees that he/she is subject to this
Policy as a condition of employment with Augusta, Georgia. The signed form will be retained in
the employee's personnel file.
3. No Form SA-3 (Test Consent Form) is required. This is due to prohibition by the FTA for
employee to sign any type of waiver including a consent form.
4. Sign an Information Request Form allowing Augusta, Georgia to submit request on drug testing
history from any DOT-regulated employers for whom you have worked within the previous two
years. (Form SA-7).
5. If you have failed or refused a DOT drug or alcohol pre-employment test within the previous
two years you must provide this information when requested.
Section 900.102 Transfers/Promotions
A. Any employee who transfers or is promoted into a safety-sensitive position will be drug tested prior
to assuming the duties of the position.
B. Any employee who is promoted or transferred so as to become a Transit Employee or CDL Holder
will be drug tested, in accordance with Federal regulations, prior to assuming the duties of that
position.
Section 900.103 Return to Duty
A. Regular Employees:
1. Employees who have successfully completed a rehabilitation program will be required to take a
drug and/or alcohol test with a negative result prior to returning to work.
2. Employees registering between .02 to .04 (but not including .04) on an alcohol breath-testing
devise will be tested prior to returning to duty to ensure the blood alcohol content is below .02
B. Transit Employees or CDL Holders: Transit Employees or CDL Holders are required to take a pre-
employment substance abuse test if they have not performed a safety-sensitive function for 90
consecutive calendar days regardless of the reason (exception ± if employee has remained in random
pool during that time, no pre-employment test is required).
Section 900.104 Post-Accident
A. Regular Employees.
1. Any employee involved in an accident or incident in the course and scope of employment
involving a vehicle where there is property damage, injury to the employee, or injury to another
person will be drug and alcohol tested. Under the authority of Augusta, Georgia this includes
Transit employees and CDL holders.
Attachment number 2
Page 167 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 168 | P a g e
Formatted: Centered
2. Any employee involved in an accident or incident in the course of employment, not involving a
motor vehicle, which results in injury to the employee or to another person and which the injured
person receives or reasonably should receive medical treatment for the injury will be drug and
alcohol tested.
3. Employees who receive medical treatment for an occupational exposure (exposure to disease,
blood borne pathogen) will not be drug or alcohol tested, if the treatment is solely for the
occupational exposure.
4. Any employee involved in an accident or incident while driving a government motor vehicle,
whether or not the employee is on duty at the time of the accident, that results in a fatality will be
drug and alcohol tested.
B. Transit Employees and CDL Holders Federal regulations establish the criteria for post-accident
testing for Transit Employees or CDL Holders. Testing will be administered when:
1. a fatality occurs from an accident;
2. the employee receives a citation under State or local law for a moving traffic violation arising
from the accident;
3. a vehicle accident involving one or more vehicles occurs and any of the vehicles cannot move
from the accident scene under their own power; or
4. the performance of an employee could have contributed to the accident, as determined by
management using the best information at the time of the decision.
C. Employees will be tested as soon as possible after the accident but not more than 32 hours after the
accident. If a test has been required by law enforcement and employer cannot test employee within
given time limit, employer can request a copy of the test results from the authorizing agency.
D. Employees who are injured in the course of their employment, and refuse medical treatment may be
tested under the provisions of "For Cause" testing. The injury must be of such gravity as to
obviously require medical attention.
Section 900.105 For-Cause (Reasonable Suspicion) Testing
A. Any employee may be tested for illegal substances and/or alcohol when, based on specific,
contemporaneous, articulable observations concerning the appearance, behavior, speech, or body
odors of an employee, it is determined that there is reasonable suspicion that the employee is
violating this Policy.
B. If you suspect an employee to be under the influence of alcohol or other drugs while at work, the
following steps are to be taken when requesting a drug screen:
1. Call the Risk Management Manager at 821-2486.
2. 5HOD\DOONQRZQIDFWRUVLQIRUPDWLRQFRQFHUQLQJUHDVRQVIRUVXVSLFLRQ QRWMXVWD³JXW´IHHOLQJ
must be able to give description/specifics/observation at that moment in time, not days earlier).
Use the FOR CAUSE TEST AUTHORIZATION FORM, Form SA-4, found in this Substance
Abuse Policy. Fill out items #1, #2 (to include all reasons), #3, and date. Then immediately
submit to Risk Management. The information is then evaluated and determined if approval for
testing is appropriate.
3. Determine if approval is appropriate.
a. Approval ± if the request is approved, the employee in question is to sign the Substance
Abuse Consent Form (Form SA-3) PRIOR to being taken for testing. When fully executed,
this form is then to be delivered in to Risk Management. Employee refusal to sign the SA-3
form will be treated as a refusal to submit under Refusal to Submit to Testing Section of this
Chapter.
b. Denial ± if the request for testing is denied, no further action is to be taken regarding the test
or against the employee.
Attachment number 2
Page 168 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 169 | P a g e
Formatted: Centered
4. ALCOHOL ± If the employee is being tested for alcohol:
a. The employee is to be taken to the designated collection site by the Director or high ranking
supervisor (the fact of testing is to be kept totally confidential).
b. If the test result is negative, the employee shall be allowed to return to work.
c. If the breath/blood test is confirmed positive, the employee is to be processed through the
normal termination process channels (i.e. placing employee on three-day administrative
leave with pay with recommendation of termination).
d. Under no circumstances is the employee allowed to operate a vehicle, including his or her
personal vehicle. A taxicab will be provided to transport the individual directly to his or her
residence if a family member is not available. This will be arranged through Risk
Management and/or the effected department.
5. OTHER DRUGS ± If the employee is being tested for drugs other than alcohol:
a. The employee is taken by the Director or high ranking supervisor (the fact of testing is to be
kept totally confidential) to the designated collection site for testing.
b. When the collection process has been completed the employee is NOT allowed to return to
work and is placed on administrative leave (leave with pay) pending the outcome of the
testing.
c. If the test results are negative the employee shall be allowed to return to work
C. An illegal substance screening which shows that a specimen may have been diluted, tampered with,
or substituted will be considered reasonable suspicion for additional for-cause testing.
D. The number of employees requested to participate in a for-cause screening based on a workplace
incident may range from a single individual to all personnel who were involved in the incident or
had access to the work area in which the incident occurred.
E. To initiate a for-cause screening, the appropriate Department Head will use the For-Cause Test
Authorization Form (SA-4) attached as Appendix 4.
Section 900.106 Random Testing Program
A. General.
1. Employees classified as safety-sensitive will be randomly tested for illegal substances. A safety-
sensitive employee may be tested up to once per month.
2. Criteria and standards for random testing for regular employees are available for review in the
Risk Management Office.
3. Criteria and standards for random testing of Transit Employees and CDL Holders are found in
the federal regulations cited above, which are available for review in the Risk Management
Office.
B. Program Integrity. To ensure the selection process maintains true random integrity, no names, social
security numbers, employee numbers or any other identification of individuals will be provided to
the agency which is responsible for selecting the random numbers to be tested, which numbers are
generated through a computer program.
C. Random Selection/Testing Process
1. Notification Process
a. Risk Management
i. Request sequence numbers from designated service provider on a monthly basis
ii. Receive numbers, match numbers with names in spreadsheet maintained in Risk
Management
iii. Generate letter for each individual selected, attach Consent Form and Collection
Site Checklist. Letters grouped by department, give to Risk Manager for signature.
Attachment number 2
Page 169 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 170 | P a g e
Formatted: Centered
iv. Send letters to Department Point of Contact via courier (point of contact
determined by Department Director
b. Department Point of Contact
i. Receives packet of letters from Risk Management containing monthly selections
for drug screening.
ii. Point of Contact secures letters to maintain confidentiality of information.
Remainder of internal process is developed by department (employees who are
selected are not to have notice of their selection prior to receipt of notification letter
from Risk Management.
iii. Testing is to be spread out throughout the month - do not try to test all employees
within a few days.
iv. Suggestion for internal process: When feasible, only Point of Contact gives letter
to each employee.
v. After employee receives this notification, the Point of Contact places the current
date and time in appropriate area on letter Employee then signs and dates Consent
Form, witnessed by person giving the notice. (Important: once notified, the
employee has 30 minutes to arrive at the collection facility listed in letter).
vi. Consent Form is left with Point of Contact who sends form back to Risk
Management to be maintained in employee drug testing file.
c. Employee carries letter showing date and time along with Collection Procedures Checklist
to the facility designated as the collection site.
2. Collection Site
a. Upon arrival at collection site, employee follows guidelines of collection site (signing in,
providing photo identification - driver's license, etc.).
b. Employee gives letter to Collection Site who verifies timeliness of arrival.
c. Employee and Collector will initial appropriate step, as it is completed on Collection
Procedures Checklist.
3. Notification by Laboratory of Testing Results
a. Risk Management is notified directly of all drug test results except those under Federal and
DOT Regulations (those results go directly to the designated Medical Review Officer).
Notification is done through a dedicated fax machine for drug testing results only.
b. Upon receipt of a drug screen showing a positive test result, Risk Management
immediately delivers appropriate paperwork to the Medical Review Officer for
determination of test results. Medical Review Officer contacts employee at work or home
(whichever is the most expedient).
c. Upon questioning employee concerning test results, Medical Review Officer makes
official determination of positive or negative test results.
d. Medical Review Officer contacts Risk Manager with official results, which are then faxed
for documentation purposes.
e. Upon receipt of documentation, Risk Management contacts appropriate Department
Director of employee. Verbal notification is given with instructions on policy, which is
followed up by written notification and instructions. Written notification includes a sample
letter for Department Director to use for notification to employee
Attachment number 2
Page 170 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 171 | P a g e
Formatted: Centered
C. MISCELLANEOUS
Section 900.201 Training
A. NEW EMPLOYEES. All full-time, regular new employees will be required to attend orientation
prior to beginning their normal work schedule. The orientation will include a program for Drug
Awareness/ Effects of Drug Abuse and a briefing on this Policy.
B. TRANSIT EMPLOYEES and CDL HOLDERS.
1. All Transit Employees and CDL Holders, whether full-time or part-time, will be required to
attend an orientation prior to performing any safety sensitive function. Orientation will include a
program for Drug Awareness/ Effects of Drug Abuse and a briefing on this Policy. Transit
Employees and CDL Holders will also be required to attend a one- hour training session on the
effects and consequences of prohibited drug use on personal health, safety, and the work
environment and on the signs and symptoms, which may indicate, prohibited drug use. An
additional hour of training will be required regarding alcohol.
2. Supervisors of Transit Employees and CDL Holders who may make reasonable suspicion
determinations will be required to attend one hour of training on drug abuse and one hour on
alcohol abuse.
C. ANNUAL TRAINING. All employees will be required to attend a one-hour class on the effects of
Drug and Alcohol abuse each year.
Section 900.202 Rehabilitation Policy
A. Voluntary Participation.
1. When a regular employee (not probationary, part-time or temporary) comes forward PRIOR to
notification of a random or for-cause test or PRIOR to an accident and/or injury, seeking help
with a substance abuse problem, that employee will be allowed to enter an approved
rehabilitation program, as outlined below. The employee is subject to all of the provisions of the
rehabilitation policy.
2. If a regular employee DOES NOT come forward as described above, and tests positive on an
illegal substance screening, that employee will be immediately recommended for termination
from employment.
3. Any employee who desires to voluntarily participate in rehabilitation will be allowed to enter an
approved detoxification and/or rehabilitation program with no Augusta, Georgia participation in
cost other than as provided under the employee's group health insurance program.
4. The employee will be allowed the use of any accrued leave time (sick and/or vacation) during
his or her absence from work for this treatment. If there is no leave time available, the employee
will be placed on leave without pay.
5. Prior to returning to work, the employee shall submit to the Risk Management Division, in
writing, proof of completion of the program and competence to return to work.
6. Employees who have completed a detoxification and/or rehabilitation program will not be
afforded any further opportunity by Augusta, Georgia or through Augusta, Georgia's resources to
re-enter a detoxification and/or rehabilitation program for a second time.
B. Participation in Rehabilitation Directly through EAP.
1. If any employee comes forward voluntarily directly to the Employee Assistance Program (EAP)
(without first going through either Human Resources or Risk Management), and the EAP finds
that the employee is a risk to the safety of himself/herself and/or others, the EAP will notify Risk
Management that the employee is seeking treatment directly through EAP.
Attachment number 2
Page 171 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 172 | P a g e
Formatted: Centered
2. The employee will not be terminated from employment unless the employee fails to enter and
successfully complete the substance abuse program designed for him/her by the EAP; however,
such employee shall be placed on leave until such time as he/she is no longer considered a risk to
the safety of himself/herself and/or others.
3. The EAP will keep Augusta, Georgia informed of the employee's progress through the
rehabilitation program.
4. The employee will be required to sign a statement prior to being admitted to the EAP
acknowledging that Augusta, Georgia may be notified of his entry into the program under the
above circumstances.
C. Failure to Complete Rehabilitation. Employees who do not successfully complete a rehabilitation
program will be terminated and may not be considered for re-hiring for a period of one year from the
date an approved rehabilitation program was successfully completed.
1. Acceptable proof of satisfactory completion of a rehabilitation program will be required before
re-hiring will be considered.
D. Disciplinary Action. Referral to the EAP does not deprive Augusta, Georgia of the option of taking
disciplinary action against any employee in accordance with this Policy.
E. Post-Habilitation
1. Any employee who successfully completes a rehabilitation program and returns to work will be
considered a probationary employee for the next three-year period.
a. The classification of "probationary" applies to substance abuse testing only, when used in the
context of this Policy. The employee shall be responsible for the costs of such tests.
b. An employee's refusal or failure of any such test will cause the employee to be immediately
terminated.
2. Prior to returning to work, the employee will be tested for illegal substances and will be tested
on an unannounced basis thereafter during the period of probation, said testing not to exceed 12
times each year.
Section 900.203 Relationship to Previously Established Procedure
A. This Substance Abuse policy becomes effective the date as determined by the Augusta, Georgia Board
of Commissions. As of its effective date, this policy replaces any previous substance abuse policy or
procedure.
B. No qualifying statement, previously established rule(s) or procedure(s) shall be used to negate the spirit
or intent of this statement or policy.
Section 900.204 Forms
A. Contractor Certificate (FORM SA-1)
B. Substance Abuse Coverage Form (FORM SA-2)
C. Test Consent Form (FORM SA-3)(Not for use by Transit/CDL - Fed Regulation)
D. For Cause Test Authorization Form (FORM SA-4)
E. Supervisor Referral Form (FORM SA-5)
F. Collection Site Checklist (FORM SA-6)
G. Information Request Form (FORM SA-7)(Transit/CDL Pre-Empl)
H. Alcohol Fact Sheet (FORM SA-8)
I. Acknowledgement of Receipt of Substance Abuse Policy (FORM SA-9)
J. Substance Abuse Index
Attachment number 2
Page 172 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 173 | P a g e
Formatted: Centered
CONTRACTOR CERTIFICATE
I,___________________________________________of________________________________________
(Contractor/Vendor's Certifying Official) (Company Name)
_______________________________________________________________________________________
(Address)
certify that a drug-free workplace will be provided for the employees of this company during the performance
of this contract pursuant to section 50-24-3 of O.C.G.A.
I further certify that in accordance with O.C.G.A. 50-24-3 paragraph (a) subsection (2), that should this
company require the services of a subcontractor as part of this contract, that all subcontractors will be
required to provide this company with a certificate of compliance for the establishment of a Drug Free Work
Place. I understand that a drug-free work place may be provided by my:
(1) Publishing a statement notifying employees that the unlawful manufacture, sale, distribution,
dispensation, possession, or use of a controlled substance or marijuana is prohibited in the
contractor's/subcontractor's workplace and specifying the actions that will be taken against
employees for violations of such prohibition;
(2) Establishing a drug-free awareness program to inform employees about:
a. The dangers of drug abuse in the workplace;
b. The contractor's/subcontractor's policy of maintaining a drug-free workplace;
c. Any available drug counseling, rehabilitation, and employee assistance program; and
d. The penalties that may be imposed upon employees for drug abuse violations.
(3) Providing each employee with a copy of the statement provided for in paragraph (1) above.
(4) Notifying each employee in the statement provided for in paragraph (1) above, that as a condition of
employment, the employee shall:
a. Abide by the terms of the statement; and
b. Notify the contractor/subcontractor of any criminal drug statute conviction for a violation
occurring in the work place within five days of the conviction;
(5) Notifying the contracting principal representative within ten days after receiving from an employee
or a subcontractor a notice of conviction as provided under paragraph (4),b above or otherwise
receiving actual notice of such a conviction;
(6) Making a good faith effort on a continuing basis to provide a drug-free workplace for employees;
and
(7) Requiring that such contractor/subcontractor include in any agreement or contract with a
subcontractor a provision that such subcontractor will provide a drug-free workplace for his
employees by complying with the provisions of paragraphs (1), (2), (3), (4), and (6) listed above.
_________________________________________________________
(Signature)
_________________________________________________________
(Printed Name & Title)
FORM SA-1
Attachment number 2
Page 173 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 174 | P a g e
Formatted: Centered
SUBSTANCE ABUSE COVERAGE FORM
I, ____________________________________, have read and understand the Augusta, Georgia Substance Abuse
Policy (the "Policy").
I further understand that the manufacture, use, possession, sale or distribution or presence in body of alcohol, drugs
or illegal substances in the work place is strictly prohibited and will lead to my immediate discharge from
employment.
For purposes of this Policy, "drugs" or "illegal substances" or "controlled substances" is defined to include illegal
street drugs, legal drugs either taken for non-medical reasons or without a valid prescription and alcohol, but not to
include prescription medication taken in accordance with a physician's prescription and instructions. I also understand
that the presence of such substances in my system during work hours places unacceptable risk and burden on the safe
and efficient operation of my job, and, consequently, is strictly forbidden.
I understand that if I am a Transit employee or an employee required to have a CDL I will be tested in accordance
with testing requirements established by Federal regulations. I understand that if I work in a safety-sensitive position
(as that is defined in the Policy), I may be tested for illegal substances on a random basis. I also understand that
Augusta, Georgia has a zero tolerance policy for safety - sensitive employees, such that I will be terminated for any
violation of the Substance Abuse Policy.
I understand that based on reasonable suspicion, I may be tested for illegal substances (a "for-cause test").
I understand that if I successfully complete a rehabilitation program and return to work for the Augusta, Georgia
Commission, I may be tested for illegal substances on a random basis up to twelve times per year for three years and
that it is my responsibility to pay for these tests as a condition of my employment.
I understand that if I am involved in an accident, which results in property damage or injury to another person; or
in my requiring and/or receiving medical attention for injuries, I may be tested for illegal substances (a "post-accident
test"). I understand that Federal testing requirements, for Transit employees and holders of CDL licenses, may require
drug and/or alcohol testing in cases of vehicle accidents, even though there may be no injuries.
I also understand that my arrest and/or conviction for off-the-job drug and/or alcohol activities, including driving
under the influence, may constitute grounds for reasonable suspicion and a for-cause illegal substances screening, and
may cause me to have action taken against me, taking into consideration (among other things), the nature of the
charges, my job assignment and my record with the Augusta, Georgia Commission.
I understand that it is my responsibility to read the Augusta, Georgia Substance Abuse Policy entirely, and that my
cooperation with, and adherence to, policies and procedures regarding substance abuse are conditions of my
employment and that if I violate or am insubordinate by refusing to cooperate with any of these policies and
procedures, I am subject to discipline up to and including discharge.
Employee Signature ______________________________________________ Date ______________
FORM SA-2
Attachment number 2
Page 174 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 175 | P a g e
Formatted: Centered
SUBSTANCE ABUSE TEST CONSENT FORM
I, __________________________________, do hereby give my consent to the Augusta, Georgia (or its
agent(s)) to collect a urine, breath and/or blood sample from me to determine if I have used illegal drugs or
misused alcohol and/or drugs or controlled substances (including the misuse of any legal drugs).
I further give my consent to Augusta, Georgia to forward the sample(s) to a qualified laboratory for its
performance of appropriate tests thereon to identify the presence of substances illegal under the Substance
Abuse Policy.
I further give the testing laboratory my permission to release the results of such test to Augusta, Georgia
Risk Management and/or the Medical Review Officer for the Augusta, Georgia government.
I understand that refusal to submit to testing or providing false information in connection with a test is
considered the same as a positive test result.
I hereby certify that I will not adulterate or substitute any urine sample given under the Substance Abuse
Policy.
Employee Signature: __________________________________________
DATE:_________________________________________
WITNESS:____________________________________
DATE:________________________________________
FORM SA-3
Attachment number 2
Page 175 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 176 | P a g e
Formatted: Centered
***PERSONAL AND CONFIDENTIAL***
FOR-CAUSE/REASONABLE SUSPICION DRUG TEST AUTHORIZATION FORM
FOR-CAUSE TEST is requested for:
Print Employee Name:
Payroll #:
Department:
Job Title
Physical Signs or Symptoms
1. Possessing, dispensing, or
using prohibited substance.
2. Slurred or incoherent speech
3. Bloodshot or watery eyes
4. Odor of alcohol
5. Odor of Marijuana
6. Runny nose or sores around
nostrils.
7. Puncture marks or "tracks"
8. Loss of physical control, poor
coordination, unsteady gait.
9. Extreme fatigue or sleeping
on the job.
10. Flushed or very pale face
11. Nausea or vomiting
12. Disheveled appearance or
out of uniform
13. Dizziness or fainting
14. Highly excited or nervous
15. Dilated or constricted
pupils or unusual eye movement
16. Excessive sweating or
clamminess of skin
17. Shaking hands or body
tremors.
18. Dry mouth
19. Breathing irregularity or
difficult breathing
20. Inappropriate wearing of
sunglasses.
21. Other (describe below)
3. Has there been a change to the employee's quality and quantity of work? NO If so describe:
4. Has the employee's work relationships changed with fellow employees? NO If so, describe:
5. Does the employee appear to "bring his personal/family problems" to work more than usual? NO If so,
describe:
6. Have you noticed any recent changes in personality, moods, or behavior? NO If so, describe:
FORM SA-4 Page 1 of 2
Attachment number 2
Page 176 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 177 | P a g e
Formatted: Centered
PAGE 2 FOR-CAUSE REASONABLE SUSPICION DRUG TEST AUTHORIZATION FORM
NATURE OF INCIDENT/CAUSE FOR SUSPICION
1. Observed possession or use of a prohibited substance
2. Apparent drug or alcohol intoxication.
3. Observed abnormal or erratic behavior.
4. Other:
2. Test requested by:
Signature
Date:
Printed Name:
Payroll #:
Job Title:
Department:
3. TEST AUTHORIZED BY:
Signature:
Date:
Printed Name:
Empl #:
Job Title:
Department:
Additional Information
______________________________________________________________________
FORM SA-4 Page 2 of 2
Attachment number 2
Page 177 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 178 | P a g e
Formatted: Centered
CONCERN: EAP SUPERVISORY REFERRAL FORM
- C O N F I D E N T I A L -
NOTE: NOT FOR INCLUSION IN PERSONNEL FILE - Please print or type
This form is to be used as a guide in determining the extent and exact nature of the decline of
your employee's job performance. Please review the form with your employee, and be sure that
both parties sign. Please call if you have any questions. Upon completion of the form please
forward to: CONCERN, Employee Assistance Program, 2610-B Commons Blvd,
Augusta, GA 30909
Telephone: 706-667-2353, Toll Free 1-888-667-2353, FAX: 706-667-2303
Name and Title of Employee :
Company: Augusta, Georgia Government Department:
CHANGES IN WORK BEHAVIOR ¥_) (Please explain in detail indicating when you first noticed changes.)
Frequent short absences
Tardiness
Unexplained disappearances from work
station:
Reduced quantity of work
Reduced quality of work
Erratic work performance
Missed deadlines
Complaints from fellow workers
Errors due to inattention or poor judgment
Repeated minor accidents on or off job
Inability to concentrate
Irritability:
Overreaction to criticism
FORM SA-5 Page 1 of 2
Attachment number 2
Page 178 of 269
Item # 11
All Rights Reserved Ȃ As provided to the Commission on 7-1-2011 179 | P a g e
Formatted: Centered
CONCERN: EAP SUPERVISORY REFERRAL FORM CONT.
Complaints of not feeling well:
Undependable statements:
Deteriorating appearance:
Outside forces (i.e., family and financial garnishments) beginning to interfere with work:
Hospitalized more than should be expected:
Changes in personality pattern:
The above listing is intended only as a guide. These indicators are most reliably applied to employees who have been good performers in the past but who have had a recent decline in job performance. Additional Information: (Please list any additional information or comments, which you feel, could be helpful. Attach additional sheets if necessary.)
RELEASE OF INFORMATION: (To be reviewed and signed during interview) I authorize CONCERN: EAP to advise the person listed below whether or not I scheduled and/or kept an appointment for services. EMPLOYEE: ________________ DATE: _____________________
Supervisor
Title:
Telephone Date:
CONTACT PERSON: TELEPHONE: (If different from above)
FORM SA-5 Page 2 of 2
Attachment number 2
Page 179 of 269
Item # 11
All Rights Reserved 180 | P a g e
Collection Procedures Check List
Employee Last Name: ______________ First Name__________ Employee number: _________
PLEASE READ!!!!
In an effort to provide the best protection possible for each employee and the collection agent, this checklist is being provided for
use with each collection. Your participation is required to ensure that each step of the collection process is completed to standard.
You will be required to initial each block by the procedure you were involved in. Your initials signify that the procedure was
completed properly. If there is any deviation of procedures you should make a note at the bottom of the sheet and sign your name. 'HVLJQDWHG(PSOR\HU5HSUHVHQWDWLYHLV6DQG\:ULJKW5LVN0DQDJHPHQW«GLUHFWDQ\TXHVWLRQVRIFRQFHUQVWRWKH'(5
# Procedure Collector Donor
1 Prepare collection site; ensure coloring agent present in commode.
2 Verify identity of employee with picture ID.
3 Prepare Top section of Chain of Custody form: (donor ID, reason for test)
4 If required: ask donor to remove bulky or unnecessary items (exterior clothing, store in
secure area.
5 Employee washes hands and returns to the collector.
6 Collector gives (sealed collection bottle) or lets donor pick (non-sealed collection
bottle). NOTE: only one collection container allowed in the rest room.
7 Employee/donor provides urine sample in the collection container and immediately
provides the container to the collector. (Note: do not flush the commode until told to
do so)
8 Collector annotates the temperature on the Chain of Custody form and insures there is
at least 45 ml. If the temperature is outside the acceptable range follow the procedures
of SAMSHA.
9 Donor observes the splitting of the sample and sealing.
10 Collector splits the sample, writes the date on the labels/seals and seals the containers
(In the presence of the donor).
11 Donor initials security seal.
12 Donor flushes the commode and washes hands.
13 Donor reads the certification statement of the Chain of Custody form and signs the
form.
14 Collector completes the Chain of Custody form and provides copy to the
employee/donor.
Collector Comments:
Employee Comments:
CERTIFICATION
I certify that the above procedures were satisfactorily completed and that any questions concerning the procedure by
the employee were satisfied at the time of the collection. I also state that I was given the opportunity to write
comments concerning any aspect of the collection process.
__________________________________ _____________ ____________________________________
(Signature of Collector) (Date) (Signature of Employee)
NOTE: This form is an internal document for use by Augusta, Georgia Risk Management and is not required by DOT/FTA
FORM SA-6
Attachment number 2
Page 180 of 269
Item # 11
All Rights Reserved 181 | P a g e
Information Request Form (Pre-Employment Transit)
I, _________________________________________ hereby allow Augusta, Georgia Transit
(Applicant) (Transit Agency)
to contact my former DOT -regulated employer(s), from the past two years, to request the following
information in accordance with 49CFR part 40.25.
1. Alcohol test results of 0.04 or higher alcohol concentration. 49CFR part 40.25(b)(1)
2. Verified positive drug tests. 49CFR part 40.25(b)(2)
3. Refusals to be tested (including verified adulterated or substituted drug test results.)
49CFR part 40.25(b)(3)
4. Other violations of DOT agency drug and alcohol testing regulations. 49CFR part
40.25(b)(4)
5. With respect to any employee who violated a DOT drug and alcohol regulation,
Documentation of the employee's successful completion of DOT return-to-duty
Requirements (including follow-up tests). 49CFR part 40.25(b)(5)
Please list former employer(s) with contact information.
_________________________________________________________________________________
_________________________________________________________________________________
_________________________________________________________________________________
_________________________________________________________________________________
__________________________
,QUHVSHFWWR'27GUXJDQGDOFRKROWHVWLQJUHJXODWLRQVRYHUWKHSDVWWZR\HDUV««
Have you ever had an alcohol test results of 0.04 or higher? Yes___ No ___
Have you ever had a verified positive drug test? Yes___ No ___
Have you ever refused to be tested (including verified adulterated or
substituted drug test results.) Yes___ No ___
Have you violated any DOT agency drug and alcohol testing regulation? Yes___ No ___
If you have violated a DOT drug and alcohol regulation, do you have documentation of successful
completion of DOT return-to-duty requirements (including follow-up tests)?
Yes___ No___
FAILURE TO PROVIDE WRITTEN CONSENT, INCLUDING FORMER EMPLOYER(S)
INFORMATION, ANSWERS TO THE QUESTIONS AND SIGNATURE, WILL RESULT IN
YOU BEING DISQUALIFIED FOR A SAFETY SENSITIVE POSITION WITH AUGUSTA,
GEORGIA TRANSIT, AS PER 49CFR PART 40.25(a).
Applicant Signature ___________________________________ Date ___________
Witness Signature ____________________________________ Date ___________
FORM SA-7
ALCOHOL FACT SHEET
Attachment number 2
Page 181 of 269
Item # 11
Attachment number 2
Page 182 of 269
Item # 11
Attachment number 2
Page 183 of 269
Item # 11
All Rights Reserved 184 | P a g e
ACKNOWLEDGEMENT OF RECEIPT
AUGUSTA, GEORGIA POLICY AND PROCEDURES ON SUBSTANCE ABUSE
I hereby acknowledge receipt of a copy of the Augusta, Georgia Policy and
Procedures on Substance Abuse on the date written below.
I further acknowledge and understand that it is my responsibility to read and
understand the policies and procedures included in this administrative
regulation.
By way of this acknowledgement, I acknowledge that I have been informed that
the Augusta, Georgia Commission may add to, revoke, and/or modify the
policies and procedures from time to time.
Date Employee Signature
Employee Printed Name
Employee Number
FORM SA-9
Attachment number 2
Page 184 of 269
Item # 11
All Rights Reserved 185 | P a g e
CHAPTER X.
SAFETY
A. GENERAL
Section 1000.001 General Safety Policy Statement
Augusta, Georgia considers the safety of its employees of paramount importance. To this end, every
effort will be made to provide the safest possible work environment and conditions. The responsibility
for conducting safe work practices rests with every employee of Augusta, Georgia. Augusta, Georgia
recognizes that the prevention of accidental injury to the employees will be successful only if there is
support from top level management, including Department Directors, adequate coordination and advice
from staff members, and willing participation by the employees.
Section 1000.002 Purpose
A. Establish the Augusta, Georgia Safety/Risk Management Program and to prescribe policies,
procedures and guidelines to implement this Program.
B. Increase the efficient use of resources through the reduction of accidents (loss of manpower
and/or material) by preventing unsafe acts, eliminating or controlling unsafe conditions and
environmental hazards, and providing safe and healthy working conditions for all employees.
C. Increase the efficiency of operations by providing technical safety advice and services.
D. Establish criteria for accident reporting, safety training, safety committees, safety awards, and
internal safety program administration.
E. Establish criteria for health protection programs not specific to single departments.
Section 1000.003 Applicability
The provisions, policies, procedures and guidance established within this Manual are applicable to all
full-time and part-time employees of Augusta, Georgia unless otherwise stated.
Section 1000.004 Program Goals
A. Create a physical and mental work environment that measurably reduces accidents and injuries
to employees.
B. Conduct a program of safety and health inspections to identify and eliminate unsafe working
conditions or practices.
C. Control health hazards and to comply fully with the safety and health for every job.
D. Provide for the personal protection of all employees against injury or illness by offering
personal protective equipment as appropriate to the job.
Section 1000.005 General Provisions
A. Accident prevention is a management/supervisor and employee responsibility. Department
Directors will establish and implement supplemental departmental accident prevention
programs designed to meet the needs of their departments and employees.
B. Accident prevention principles and techniques will be incorporated into all phases of planning,
training, operations, and services. Safety standards, policies, and programs adopted under this
program will be used as a basis for the prevention and reporting of accidents.
C. Risk Management will provide safety program support as requested by Department Directors or
department safety officers.
Attachment number 2
Page 185 of 269
Item # 11
All Rights Reserved 186 | P a g e
D. All levels of management/supervisors will ensure prompt attention is given to reports by
employees or others regarding unsafe or unhealthy work conditions.
E. Employees will be provided personal protective items as appropriate to their duties. This
equipment will be provided by the department at no cost to the employee. "Share cost" by the
employee, for required safety items, is inappropriate and will not be authorized by any
department under the authority of Augusta, Georgia.
F. The Department Directors, with the assistance of the Safety Officer and Risk Management, will
analyze hazardous conditions plus work tasks and develop standard operating procedures to
insure that the hazardous conditions are minimized and that safe work practices are used.
G. It shall be the responsibility of every employee to make safety a part of their daily job,
irrespective of the capacity they may function in the organization.
H. No employee will accept liability or responsibility for damages, injuries, or wrongdoing in the
name of Augusta, Georgia, its various departments, or contractors. All issues relating to
liability, damage, and/or wrongdoing will be referred to Risk Management or Department Head.
Section 1000.006 Administration
A. Departments will implement an employee bulletin board or bulletin area. It shall be accessible
to all employees within the department.
B. Departments operating out of several areas are encouraged to construct multiple bulletin
boards/areas to ensure dissemination of employee information.
C. The board/area will be divided into two sections:
1. Permanent Items
a. Required posting under Federal and State Law - examples - Fair Labor Rights -
U.S.D.L.; Americans with Disabilities Act; Workers Compensation Panel of 3K\VLFLDQV(PSOR\HH¶V%LOORI5LJKWV :RUNHUV&RPS
b. Department policies
2. Temporary Items
a. "Safety Grams"
b. Department announcements
D. Boards will be kept in a neat and orderly appearance. Department Directors will appoint an
employee to be responsible for maintaining the board.
Section 1000.007 Safety Policy Responsibilities
Individuals and groups shall be responsible for instituting the safety policy as described in the
Sections below.
Section 1000.008 Risk Management Committee ± See also Section F of this Chapter
A. Makes recommendations for policy to the Augusta, Georgia Commission in the areas of the
safety program and insurance.
B. Reviews actions of the Safety Review Committee;
C. Acts as the appellate authority for the Safety Review Committee.
Section 1000.009 Safety Review Committee ± See also Section E of this Chapter
A. Reviews all property damage involving employees to determine personal liability and makes
recommendations concerning policy, as appropriate, to Risk Management Committee.
1. May recommend the employee be found at fault as a major contributor to the proximate
cause of the accident and disciplinary action as appropriate.
2. May recommend the employee be found not at fault as a major contributor to the proximate
Attachment number 2
Page 186 of 269
Item # 11
All Rights Reserved 187 | P a g e
cause of the accident.
3. Reviews safety inspection reports, and accident analyses, taking or recommending
appropriate actions necessary to ensure an effective safety program.
4. Considers assignments for special safety inspections, investigations of serious accidents,
training programs and special safety problems.
Section 1000.010 Finance Department Director
A. Responsible for administering and supervising the Augusta, Georgia Safety and Risk
Management Program.
B. Develops, coordinates, and conducts an aggressive safety program.
C. Takes all actions deemed essential to produce a positive reduction in accidents and determines
their causes.
D. Provides technical guidance and direction to personnel and all levels of management in the
implementation of safety policy and Loss Prevention program.
E. Implements inspection programs to detect existing or potential accidents and health hazards and
recommends corrective or preventive measures where indicated.
F. Participates in the investigation of accidents and injuries and cooperates in the preparation of
reports and evidence for Augusta, Georgia use.
G. Stops hazardous jobs when prescribed safety precautions are not being enforced.
H. Conducts inspections of equipment, materials, operations or activities to ensure public and
employee safety.
I. Administers and coordinates workers compensation claims.
J. Periodically evaluates compliance with the program within the divisions and departments.
K. Periodically attends department staff and safety meetings to promote maximum understanding
of the program objectives.
L. Maintains complete records on accidents and publicizes information which will apprise
management and employees of trends.
Section 1000.011 Department Directors
A. Responsible for all aspects of safety within their respective departments.
B. Appoints a departmental safety officer to assist in the department safety program (see
Department Safety Officers below).
C. Maintains safe and healthful working conditions within their department.
D. Controls injuries, collisions, liabilities, and waste material within the department by establishing
policies and procedures particular to the department.
E. Publishes an appropriate safety manual or plan designed to accomplish objectives of this
program and objectives unique to their department with a copy to be provided to Risk
Management.
F. Charges each supervisor to be fully accountable for an explanation of injuries, collisions and
liabilities incurred by their employees.
G. Provides leadership and positive direction essential in maintaining Augusta, Georgia safety
policies as a prime consideration in all operations.
H. Ensures employees receive appropriate training in those tasks the employee is to accomplish.
Training will include safety factors involved in the task(s). Sustainment training and remedial
training will be provided as necessary.
I. Ensure hazardous tasks are covered by specific published work rules and employees involved
with these tasks have read, understood, and demonstrated their abilities to accomplish the tasks.
A record of training will be maintained by the department.
J. Provides personal protective items for hazardous tasks as necessary and provides instruction for
item use and care.
Attachment number 2
Page 187 of 269
Item # 11
All Rights Reserved 188 | P a g e
K. Ensures all new employees are briefed on safety policies within the department.
Section 1000.012 Supervisory Personnel
A. Responsible for the safe actions of their employees and the safe performance of machines and
equipment within their operating areas.
B. Enforces the provisions of the policies listed in this manual.
C. Assumes full responsibility for safe and healthful working areas for their employees while they
are under their supervision.
D. Ensures all safety policies and regulations are fully implemented for maximum efficiency of
each job.
E. Takes the initiative in recommending correction of deficiencies noted in facilities, work
procedures, employee's job knowledge, or attitudes that adversely affect loss prevention efforts.
F. Is firm in enforcement of work policies and procedures by being impartial in taking consistent
disciplinary action against those who fail to conform, and by being prompt in giving recognition
to those who perform well.
G. Ensure each employee is fully trained for the job they are assigned and they are familiar with
published work rules.
H. Ensures all employees attend training classes when conducted.
I. Inspects all tools and equipment at frequent intervals and keeps in a safe and serviceable
condition.
J. Ensures untrained employees are not permitted to operate any mechanical or electrical
equipment until thoroughly trained.
K. Instructs all employees about the reporting of all accidents and the necessity of receiving first
aid treatment, even in cases of minor injuries.
L. Maintains a continuous program of on-the-job training and supervises workers in the
accomplishment of all potentially hazardous activities.
M. Uses safety checklist(s) for the accomplishment of hazardous operations.
N. Properly maintains all personal protective devices and safety equipment.
O. Ensures all employees are physically qualified to perform their work.
P. Marks all areas designated as dangerous with the type of hazards involved.
Q. Ensures as few persons as possible are permitted to enter hazardous work areas.
Section 1000.013 Department Safety Officers
A. Recommends necessary safety equipment and personal protective clothing and devices to be
used by employees.
B. Instructs employees in the need for and use of personal protective equipment for hazardous jobs.
C. Conducts training for employees as to an acceptable way for accomplishing a hazardous job.
D. Conducts monthly safety meetings to review accidents, analyze their causes, and promote free
discussion of hazardous work problems and possible solutions. The Safety Officer will
maintain a file of meetings for review. A copy will be sent to Risk Management.
E. Reviews all accident and incident reports to insure that the investigation was thorough, the
report is complete, and forward reports to Risk Management.
F. Conducts monthly inspections of work areas and equipment to insure that conditions are
satisfactory from an accident prevention standpoint.
Section 1000.014 Employees
A. Employees are required, as a condition of employment, to exercise due care in the course of
their work to prevent injuries to themselves, to their fellow workers, and to members of the
public and to conserve materials.
Attachment number 2
Page 188 of 269
Item # 11
All Rights Reserved 189 | P a g e
B. Reports all unsafe conditions and unsafe acts to their supervisor and safety officer.
C. Keeps work areas clean and orderly at all times.
D. Follows prescribed procedures during an emergency.
E. Reports all accidents immediately to their supervisor.
F. Makes certain they understand instructions completely before starting work.
G. Learns to lift and handle materials properly.
H. Avoids engaging in any horseplay and avoids distracting others.
I. Knows how and where needed medical attention may be obtained.
J. Avoids damaging or destroying any warning or safety device, or interfering in any way with
another employee's use of them.
K. Reports all injuries, no matter how minor, to their supervisor and safety officer;
L. Familiarizes themselves with personnel policies pertaining to workers compensation injuries.
M. Each employee working at hazardous jobs will:
1. Obey all safety rules and follow published work instructions. If any doubt exists about
the safety of doing a job, they will stop and get instructions from their supervisor before
continuing work.
2. Operate only machines and equipment that they have been authorized to operate by their
supervisor.
3. Use only the prescribed equipment for the job and handle it properly.
4. Wear required personal protective equipment when working in hazardous operational
areas.
5. Dress safely and sensibly.
a. No loose clothing around machinery.
b. No jewelry around machinery.
c. Wearing proper footgear/shoes - the wearing of high heeled shoes for women is
not encouraged.
d. See Personal Protective Equipment.
Section 1000.015 Condition of Employment
All employees, full time, part time, and temporary, will execute their job duties in a legal, lawful, safe
and expected manner. Failure to do so may lead to immediate termination.
Attachment number 2
Page 189 of 269
Item # 11
All Rights Reserved 190 | P a g e
B. VEHICLE SAFETY
Section 1000.101 General Vehicle Safety Policy
A. Augusta, Georgia vehicles are easily identified as such and thus constitute a traveling
advertisement seen by many citizens. They have very high exposure. In this relationship with
other motorists and pedestrians while operating vehicles, the employee controls an important
influence on public relations. By using courteous, considerate driving habits, employees can
build good public relations if they apply the principles of defensive driving to avoid accidents.
Only employees may drive Augusta, Georgia vehicles. Exceptions may ONLY be approved by
the appropriate Administrator.
B. All drivers of Augusta, Georgia vehicles will abide by the laws, regulations, and directives of
Georgia traffic laws, signs, signals and markings.
C. All drivers of Augusta, Georgia vehicles will abide by local traffic ordinances and driving
regulations.
D. All drivers of Augusta, Georgia vehicles will exercise "due care" in the operation of their
vehicle; specifically, the driver must operate his or her vehicle as a prudent person would in a
given situation, seeking to avoid unreasonable risk of harm to themselves and others. This
provision applies to emergency vehicles and non-emergency vehicles.
Section 1000.102 Vehicle Safety Responsibilities
A. DEPARTMENT DIRECTORS
1. Establish policies for their departments which support safe operation of motor vehicles.
Policies should include driving on improved (hard surface) roadways, unimproved
(dirt/gravel) roadways, and construction areas. Policies will be in written form with copies
to Risk Management.
2. Establish a training program which ensures all employees driving Augusta, Georgia vehicles
are familiar with policies of Augusta, Georgia, as well as the department policies.
3. Ensure all employees driving Augusta, Georgia vehicles attend defensive driving within 6
months of employment. Departments will maintain records of attendance.
4. Ensure all employees driving Augusta, Georgia vehicles have a valid state driver's license
and are full-time employees at least 21 years of age.
5. Assist in the enforcement of policies established by Augusta, Georgia.
6. Establish a system of safety checks for motor vehicles. Safety checks are to be performed
by the driver at the beginning of each driving day. (See Forms RM- sample daily checks).
7. Publish operating procedures for emergency or specialized equipment, procedures will be in
writing. Procedures will be submitted to the Safety Review Committee chairperson and to
the Sheriff's Department for review. Such equipment includes:
a. Police vehicles;
b. Emergency service vehicles;
c. Dump trucks;
d. Any vehicle weighing in excess of 10,000 pounds (Gross Vehicle Weight)
e. ULV Aerosol Generators.
B. SUPERVISORS
1. Ensure drivers conduct daily vehicle inspections.
2. Ensure drivers are trained in the provisions of the Vehicle Safety Section.
3. Perform weekly checks for valid driver's license of employees driving Augusta, Georgia
vehicles.
4. Assist in accident investigations as required.
5. Ensure scheduled maintenance is conducted.
C. DRIVERS
Attachment number 2
Page 190 of 269
Item # 11
All Rights Reserved 191 | P a g e
1. Adhere to the provisions of this section in its entirety.
2. Ensures he/she has a valid driver's license in their possession while driving an Augusta,
Georgia vehicle.
3. Inspect the vehicle at the beginning of each driving day. Items to inspect can be found at
Form RM for vehicles requiring a Class C license and Form RM for CDL. Inspection check
sheets provided in this manual are not intended to replace the provisions of law. Drivers are
responsible for ensuring any and all legal requirements for safety inspections are met.
3.2.4
D. DEPARTMENT SAFETY OFFICERS
1. Ensure "pre-operation" daily checks are made.
2. May declare a vehicle "out of service" or "deadline" a vehicle for safety hazards.
E. RISK MANAGEMENT SAFETY OFFICER
1. Will make periodic inspections of any Augusta, Georgia owned vehicle to ensure safety and
driver compliance with policy.
2. Has the authority to declare a vehicle "out of service" or "deadline" as a result of a safety
problem.
3. Has the authority to temporarily suspend driving privileges of employees in Augusta,
Georgia vehicles observed driving recklessly. A written report of the action/conduct and
description of the observation will be provided to the department head within one working
day.
Section 1000.103 Driver Pre-Operation Inspections
A. Non-commercial vehicles - Safety checks will include as a minimum
1. Lights
2. Horn
3. Directional Signals
4. Brakes, brake lights and brake fluid
5. Motor oil
6. Power steering fluid
7. Windshield washers and wipers
8. Tires (tread and inflation)
9. Clutch travel
10. Hydraulic systems
11. Proper latching of seat belts
B. Commercial type vehicles (CDL) - The minimum requirements are established as law and all
drivers applying for a Commercial Drivers License (CDL) must demonstrate their knowledge of
"pre-trip" inspections prior to being approved for a license. Drivers are responsible for
conducting all safety inspections prescribed by law - pre-trip, during operations inspection, and
end of the driving day inspection.
Section 1000.104 General Vehicle Safety
A. Position all adjustments for safe driving before putting the vehicle into gear such as - the seat,
properly adjust seat belts, inside and outside mirrors, and seating positions.
B. Drivers of Augusta, Georgia vehicles must possess a valid state driver's license and they must
be thoroughly familiar with the state and local regulations governing motor vehicle operation.
The fact that an employee is operating an emergency vehicle does not absolve them from civil
or criminal liability for the consequences of wanton reckless driving. The driver must be in the
position to satisfy a jury that they used reasonable care and prudence in operating emergency
vehicles. Even though emergency equipment has warning devices, the drivers are expected to
PROCEED WITH DUE CAUTION.
Attachment number 2
Page 191 of 269
Item # 11
All Rights Reserved 192 | P a g e
C. All slow moving equipment operated in public right-of-ways shall be equipped with proper
flashing lights, proper signage (slow moving vehicle) and other devices required by the Georgia
Vehicle Code.
D. Load Security
1. Supplies transported in motor vehicles shall be secured in such a manner that they will not
be dislodged or fall out or forward during transit or sudden stops.
2. Drawers in moveable trucks shall always be secured before the truck is driven.
3. Ensure load capacity is not exceeded.
E. Drugs or any medication which might affect the ability to drive are not to be taken before
operating vehicles. Drugs, illness, or extreme fatigue may affect ability to judge distances,
speed, and driving conditions. Employees must notify their supervisor of medications prior to
operating equipment/vehicles.
F. All persons who drive or ride in Augusta, Georgia vehicles will, in all cases, wear the installed
seat belts. The number of seat belts available will establish the maximum passengers of the
vehicle. Passengers will not be authorized to ride in the "bed" of pick-up trucks, dump trucks or
other utility type vehicles.
G. Not more than three (3) persons, including the driver, shall be permitted to ride in the front seat
of any vehicle. Persons shall not be transported in any vehicle unless safe and secure seating is
provided for each such person and a seat belt is available for all passengers.
H. Parking vehicle
1. Except when working conditions require otherwise, parked vehicles must have motor
stopped, emergency brake set, put gear in park, and keys removed.
2. If on a downgrade, front wheels to be turned toward the curb. If on an upgrade, front wheels
to be turned away from the curb. Brakes set and transmission left in "park" before driver's
seat is vacated.
3. Vehicles will not be parked on the wrong side of the street facing traffic except in case of
emergency.
4. Before leaving the curb, it is essential to see that no cars are approaching from either
direction, and signals are to be used.
I. When backing up a vehicle, it is necessary to see that the way is clear. The driver should get out
of the vehicle when necessary and inspect the area to be backed into slowly. Horn is to be
sounded while backing. If there is another employee along, he will get out and direct the
backing. Drivers of dump trucks or heavy construction equipment will, if the vehicle has been
parked, prior to backing, actually go to the rear of their vehicle to ensure the area to the
immediate rear is clear prior to backing the vehicle.
J. The vehicle is never to be left unattended with the motor running (excluding emergency type
vehicle). Drivers will not go further than 10 feet from any point of the vehicle while running.
When parked and unattended, the vehicle will be locked.
K. Drivers must be particularly alert while driving near children. Children must be kept from
playing in or around Augusta, Georgia owned vehicles. While working areas such as schools,
parks, playgrounds, swimming pools, or community centers, drivers will be especially watchful
for children and will drive carefully and slowly at all times.
L. Driver must stay within posted speed limits and slow down when conditions warrant.
1. Vehicles pulling trailers will not exceed 25 miles per hour in residential areas, nor 45 miles
per hour in non-residential or open roads, unless the posted speed is less, in which case the
posted speed will be adhered to.
2. Vehicles requiring drivers to have CDL licenses to operate the vehicles will not exceed 30
miles per hour in residential areas, nor 45 miles per hour in non-residential or open roads,
unless the posted speed is less, in which case the posted speed will be adhered to.
M. THE RIGHT-OF-WAY IS NOT TO BE ASSUMED. The driver who has the last chance to
avoid an accident may be the driver in the legal right. DON'T BE PUSHY - YIELD OR STOP.
N. The distance behind other vehicles is to be maintained so as to avoid tailgating and every effort
Attachment number 2
Page 192 of 269
Item # 11
All Rights Reserved 193 | P a g e
made not to allow others to tailgate. If necessary, slow down in an effort to allow the other
driver to either slow down or pass your vehicle. If the driver that is tailgating your vehicle
appears to be impaired it would be wise to pull over to allow them to go ahead of you.
O. Intentions will be signaled at least 100 feet in advance, including a change in lanes, and changes
in direction. Avoid sudden braking.
P. Low beam headlights will be turned on during the dark period of the day such as during rain
storms and fog. Headlights should be "on" 1/2 hour before sunset until 1/2 hour after sunrise
when driving. Parking lights designate a vehicle is parked. Vehicles are never to be driven with
only parking lights on.
Q. Filling tanks
1. Motor of the equipment to be shut off.
2. No smoking near gasoline pumps.
3. Hose nozzle to be kept against the edge of filler pipe.
4. Tank not to be filled too fast or too full to avoid spilling gasoline.
Section 1000.105 Seat Belts
A. Augusta, Georgia has declared that any and all passengers, including the driver, riding in a
vehicle owned by Augusta, Georgia are required to properly wear installed seat belts when
operating an Augusta, Georgia vehicle. Exceptions are as follows ±
1. Tractors without a "Roll-Over Protection System´ (ROPS)
2. Specialized construction equipment.
3. Prisoner/suspect of law enforcement officers being transported for short distances in the
back seat of the vehicle when restraining devices or other circumstances prevent the proper
wearing of seat belts.
4. Other exceptions must be requested in writing giving a full justification. Requests will be
addressed to Risk Management for presentation to the Commission.
B. Failure to use your seat belt is a serious safety violation and is not to be taken lightly. It is a
known fact that seat belts can and do help reduce the severity of injuries when they are properly
used. Proper use constitutes proper adjustments as well as proper latching of the unit.
Employees who receive an auto allowance for operating their personal vehicle while on
Augusta, Georgia business are required to wear their seat belts in their personal vehicles as well
as those in Augusta, Georgia vehicles. To bring employees into compliance with this policy:
1. First Offense - Will result in a written warning;
2. Second Offense - Will result in a two-day suspension without pay.
3. Third Offense
a. For those who drive Augusta, Georgia vehicles, will result in the loss of driving
privileges for those who drive Augusta, Georgia vehicles;
b. For those who receive auto allowance, will result in the forfeiture of that allowance.
Section 1000.106 Items Prohibited from Being Carried in Augusta, Georgia Vehicles
A. The following items are not authorized for transport in vehicles belonging to Augusta, Georgia.
1. Any item classified as contraband or illegal substance. (Exception - Public Safety Officers
when in the execution of their legal and expected duties.)
2. Firearms or weapons of any type except by Public Safety Officers who are certified and hold
a position of employment by Augusta, Georgia as a certified Public Safety Officer (i.e. -
Sheriff Office Deputies/Investigators, Deputy Marshals, Arson Investigator, RCCI
Correction Officers and officials of the DA's office).
3. Alcoholic beverages.
Section 1000.107 Reporting Driving Citations/Violations
Attachment number 2
Page 193 of 269
Item # 11
All Rights Reserved 194 | P a g e
A. All employees whose job requires they drive Augusta, Georgia vehicles are required to report
any and all traffic/moving vehicle violations to their supervisor, regardless of whether the
citation was issued in the course of employment or not.
1. Employees whose licenses are suspended will not be allowed to drive Augusta, Georgia
vehicles while their licenses are suspended.
2. Employees are not allowed to operate an Augusta, Georgia vehicle while in possession of a
temporary driving permit, i.e. court issued driving permit for the purpose of driving to and
from work, etc.
3. Employees hired as drivers (primary job duty) and whose license has been suspended may
be subject to termination for loss of job qualifications. (See Personnel Policy).
4. Employees who drive Augusta, Georgia vehicles, who have a suspended license and fail to
report the suspension, will be subject to termination for their failure to advise Augusta,
Georgia of their invalid license status
Section 1000.108 Motor Vehicle Records Check
A. Potential Employees - Persons applying for a position requiring the driving of Augusta, Georgia
owned vehicles (any position which requires the applicant to drive an Augusta, Georgia vehicle
as a major function of his or her job) will be required to sign a release allowing Augusta,
Georgia to run a seven (7) year driving history at the time of job offer if a resident of Georgia If
not a resident of Georgia then the applicant will need to provide this record from the state of
residency of the potential new hire. Potential employees who fail to provide the required
records check or who refuse to sign a release for such records will not be considered qualified.
See Addendum MVR Review Form for evaluation criteria.
B. Employees whose license is suspended for traffic violations of Driving Under the Influence
(DUI), and whose job requires they drive an Augusta, Georgia vehicle may be terminated for
failure to perform job responsibilities.
C. Any employee who is subject to drive an Augusta, Georgia vehicle may have a Motor Vehicle
Records check directed/requested as a condition of employment. Only Department Directors,
Attorneys of the Law Department, Safety Review Committee, Risk Management Committee,
Risk Management Director or Assistant Director, or Augusta, Georgia Administrator can direct
the check.
D. Employees who have been involved in two or more vehicle accidents within a one year period
or whose Motor Vehicle Records Check shows repetitive traffic violations may have their
Augusta, Georgia vehicle driving privileges revoked.
1. Risk Management will identify employees in this category and forward the necessary
information to the Risk Management Committee for appropriate action. The employee will
be notified in writing that his or her driving record is being reviewed and they should attend
the meeting to present reasons why their driving privileges for Augusta, Georgia vehicles
should not be revoked.
2. Risk Management Committee has the authority to direct a Letter of Intent to terminate the
employee's employment for continued unacceptable driving practices.
E. A Motor Vehicle Records Review Form (See Addendum ___) will be completed for any
employee or potential employee subjected to a Motor Vehicle Records Check. The following
standards will be applied to the results of the MVR Review Form:
1. Unacceptable: Termination of Augusta, Georgia driving privileges;
2. Questionable: Probation of Augusta, Georgia driving privileges and attendance at
mandatory driver training with testing; Any further violations while on probation status can
result in potential termination of Augusta, Georgia driving privileges.
3. Marginal: Augusta, Georgia driving privileges are maintained with the stipulation that they
attend mandatory driver training to include testing . Any future violations, depending on
Attachment number 2
Page 194 of 269
Item # 11
All Rights Reserved 195 | P a g e
the MVR Review Form score will/can result in potential probation or termination of
Augusta, Georgia driving privileges.
4. Acceptable: Augusta, Georgia driving privileges maintained; and
5. Adjustments: If an individual has not had a serious violation within three (3) years of the
MVR Review Form scoring, subtract three (3) points from the MVR Review Form score for
good behavior and apply the appropriate standard as described above.
Section 1000.109 Age and Employment Status Restrictions
A. ([FHSW IRU HPSOR\HHV KDYLQJ D FRPPHUFLDO GULYHU¶V OLFHQVH WKH PLQLPXP DJH IRU GULYLQJ
Augusta, Georgia vehicles is 21 years old.
B. ([FHSW IRU HPSOR\HHV KDYLQJ D FRPPHUFLDOGULYHU¶V DQG $LUSRUW HPSOR\HHVRQO\ IXOOWLPH
regular employees are authorized to drive Augusta, Georgia vehicles unless specifically
approved by the Administrator.
Section 1000.110 General Vehicle Accident Provisions
A. In the event of a vehicle accident involving Augusta, Georgia owned vehicles, the following
procedures will be followed:
1. Administer first aid.
2. Notify the appropriate police agency, department head and supervisor.
B. The driver involved should exchange names, driver's license numbers, vehicle tag number and
insurance data with the other person(s) involved. OFFER NO INFORMATION REGARDING
THE RESPONSIBILITY FOR THE ACCIDENT OR WHAT SHOULD HAVE BEEN DONE
TO AVOID THE ACCIDENT.
C. Report the accident to supervisors as soon as possible. The supervisor shall make a written
report to their respective department. Such reports will include a statement from the employee
involved, any employee that was a witness, and the name of the insurance carrier and agent of
the other parties involved. The form located at Appendix 5 will be used (Fleet Accident
Report). This form will be submitted only if a Motor Vehicle Accident Report is not filled out
by a law enforcement officer.
D. All serious accidents and/or accidents involving bodily injury or a fatality will be reported to
Risk Management IMMEDIATELY.
Section 1000.111 Vehicle Accident Responsibilities
A. DEPARTMENT DIRECTORS
1. Ensure all employees are familiar with all sections under General Safety.
2. Develop a system of notification within their respective department.
3. Promote driver safety and vehicle accident safety.
4. Ensure a prompt department investigation is conducted into the circumstances leading to the
accident.
B. SAFETY REVIEW COMMITTEE
1. Serves as the administrative board of inquiry to identify the causes of accidents involving
vehicles, property damage and employee injuries in order to establish responsibility and
derive means to reduce accidents involving Augusta, Georgia owned vehicles and
personnel.
2. Reviews all accidents resulting in property damage or personal injury to employees,
including vehicle accidents, to determine the cause and to establish responsibility or
culpability where appropriate.
3. Assess penalties based on damage assessments, directs retraining and establish needed
procedures when shortcomings have been identified.
Attachment number 2
Page 195 of 269
Item # 11
All Rights Reserved 196 | P a g e
a. Penalties/damage assessments will be established as a percentage based on the cost of
physical damage. (See Safety Review Committee section)
b. Risk Management Committee will periodically review the percentage formula to make
adjustments as necessary. This action will be recorded in the minutes of Risk
Management Committee and published to all Departments in a separate letter.
c. Where flagrant and/or repeated violations occur, the Risk Management Committee will
notify the appropriate department head and suggest further training or disciplinary
action be taken.
d. When appropriate, the board may recommend reassignment to a non-driving position or
the termination of the employee.
C. SUPERVISORS
1. Ensure drivers of Augusta, Georgia vehicles are trained on all sections under General
Safety.
2. Periodically inspect vehicles driven by employees under their supervision to ensure driver
compliance with policy to conduct daily inspections and ensure no damage goes
unreported.
3. Ensure any damages or accidents are reported immediately and that the "Fleet Accident
Report" Form RM-FAR is prepared and forwarded, to include witness statements,
whenever a police report is not made out.
4. Ensure any common use vehicle is inspected by the driver for safety and condition prior to
operation.
5. Ensure any employee involved in an accident or as a witness to an accident involving an
Augusta, Georgia vehicle is available to the Safety Review Committee when requested.
No supervisor has the authority to deny an employee the time to attend the Safety Review
Committee.
D. RISK MANAGEMENT
1. Maintains files on each driver involved in an accident and vehicle which has been damaged.
2. Process reports of accidents, incidents or reports of damage.
3. Coordinates the repair of all vehicles.
Section 1000.112 Vehicle Accident Procedures
A. When an accident occurs or damage to a vehicle noticed, the driver will:
1. Give assistance as required to others involved. The accident will be reported immediately.
If the vehicle is equipped with a radio and it is operational, the driver will report the accident
immediately. The driver will get the names, addresses and phone numbers of anyone
involved, including any witnesses.
2. Vehicles will not be moved from the accident scene until released by local law enforcement
officers investigating the accident. If the vehicle is safe to operate, it will be driven to the
respective department or maintenance shop immediately. The supervisor and driver will
complete the "Fleet Accident Report Form RM-FAR if a Motor Vehicle Accident Report is
not prepared by the law enforcement officer investigating the accident. The "Fleet Accident
5HSRUW´LVWRLQFOXGHDQ\ZLWQHVVVWDWHPHQWVIURPRWKHUAugusta, Georgia employees, if
involved. The report will be sent through department channels to Risk Management.
3. If the vehicle is not drivable, the "listed" towing service will be used. Normally this will be
called in by the law enforcement officer. The vehicle will be taken to the appropriate
maintenance shop.
4. The driver will be notified by letter of his case being reviewed by the Safety Review
Committee (SRC). Drivers and/or witnesses will be allowed to appear before the SRC. NO
SUPERVISOR MAY DENY ANY EMPLOYEE THE RIGHT TO APPEAR BEFORE
THE COMMITTEE. Any driver wishing another Augusta, Georgia employee, who has
direct knowledge of the incident, to be present at the SRC may request their attendance by
Attachment number 2
Page 196 of 269
Item # 11
All Rights Reserved 197 | P a g e
notifying Risk Management by phone, and requesting their presence. This should be done
as soon as possible after receiving the letter of notification.
5. The Committee will review all information concerning the accident and take appropriate
action.
6. The driver will be informed of any decision with regard to his or her involvement in the
accident. This will be done in letter form. Any employee has the right to appeal to Risk
Management Committee. See Section 8 - Safety Review Committee.
Section 1000.113 Damaged Vehicles
Any Augusta, Georgia vehicle which has been involved in an accident and must be towed to the
appropriate shop will be under "quarantine" until released by the Director over Risk Management or the
Risk Management Manager. No one is authorized to touch, remove items, move or remove parts, or
otherwise physically alter any part of the vehicle unless authorized to do so by the Director over Risk
Management or the Risk Management Manager. The only exception would be the authorized law
enforcement investigator. This provision will ensure protection of physical evidence for potential
liability.
Section 1000.114 Vehicle Accident Investigation Purpose
The purpose of this section is to establish policy, guidance and assign responsibility for the investigation
of accidents or damage to vehicles owned by Augusta, Georgia.
Section 1000.115 Required Vehicle Accident Investigations
A. A Fleet Accident Report Form RM-FAR or Georgia Motor Vehicle Accident Report will be
completed on the following:
1. Any traffic or non-traffic accident involving an Augusta, Georgia owned vehicle which does
not result in a police report being completed, regardless of the law enforcement agency.
2. Any traffic or non-traffic accident which results in damage to property, Augusta, Georgia or
privately owned, involves an Augusta, Georgia vehicle and for which a Motor Vehicle
Accident Report is not completed.
3. Any traffic or non-traffic accident involving a non-motorized secondary vehicle (i.e. trailer)
which receives damage or causes damage to public or private property and for which a
police report is not completed.
4. Any Augusta, Georgia vehicle which receives damage as a result of vandalism, an
unreported previous accident or is otherwise damaged without the immediate knowledge of
the primary driver or department (for common use vehicles) and a police report is not made
out.
Section 1000.116 Vehicle Accident Investigation Responsibilities
A. RESPONSIBILITIES -
1. DEPARTMENT DIRECTORS -
a. Establish procedures to appoint a department investigating officer for any accident
identified in the Accident Investigation Section.
b. Ensure employees designated as drivers are informed of their reporting
responsibilities for vehicle accidents.
c. Ensures an accident investigation is initiated as soon as practical and results are
forwarded to the Risk Management Department within 24 hours of the accident.
2. DEPARTMENT SAFETY OFFICERS -
a. Reviews all department accident reports for completeness and accuracy.
Attachment number 2
Page 197 of 269
Item # 11
All Rights Reserved 198 | P a g e
b. Recommends changes in department policy or driving practices as appropriate.
c. Coordinates with the Risk Management Department for technical assistance as
required.
3. DRIVER
a. Report any accident or damage to Augusta, Georgia owned vehicles as described in
Accident Investigation Section
b. Assist in the investigation by writing a full description of the accident or
circumstance of damage.
Section 1000.117 Preparation of the Fleet Accident Report
A. General - The Fleet Accident Report will be prepared by the driver's supervisor or departmental
investigating officer, as directed by the department head, within 24 hours of the accident or
report of damage.
B. Explanation of Information Required ±
1. Page 1 information
a. Date of Accident - List the month, day and year.
b. Day of the Week - List Monday through Sunday.
c. Time - The time the accident occurred.
d. Number of Vehicles Involved - In the box provided write the number of vehicles
involved by type, Augusta, Georgia or private.
e. Case No. - Leave blank.
f. Location - Mark the box if the accident occurred at an intersection. Describe the
location as best you can in the space provided. House numbers or block numbers
may be used.
g. 7-14 - These blocks concern driver information of the Employee. 'ULYHU¶V license
information should be taken directly from the GULYHU¶V license only.
h. 16-23 - Identify the Augusta, Georgia vehicle involved in the accident.
i. Driver Cited - Indicate by marking the appropriate box whether the employee was
given a written citation.
j. Insurance Information - The information has been provided.
k. Vehicle Removed By - Check the box as appropriate, if the vehicle was towed write
the name of the tow service.
l. Number of Injuries - If there were no injuries check the box "none". If personnel
were injured indicate the total number of Augusta, Georgia employees injured.
m. Private Vehicle - Indicate all known information about the Other Driver, of particular
importance is the phone number of the other driver.
n. If the driver is not the owner of the vehicle write any information concerning the
owner of the vehicle. If the vehicle belongs to a commercial business indicate the
business.
o. Vehicle Information - provide as much information on the other vehicle as possible.
p. Driver Cited - Indicate YES only if the other driver was given a written citation.
q. Insurance Information - This information should be taken directly from the white
insurance card of the other driver, if the white insurance card is not shown put "No
proof of insurance".
r. Vehicle Removed By - If the private vehicle was towed, check the appropriate box
and indicate the Wrecker Service.
s. Number of Injuries - Give the total number of people injured in the other vehicle. If
none mark the box "None".
t. Report Submitted By - Print the name of the employee submitting the report.
u. Job Title - Indicate the job title of the employee submitting the report.
Attachment number 2
Page 198 of 269
Item # 11
All Rights Reserved 199 | P a g e
v. Report Reviewed By - Print the name of the Supervisor reviewing the report for
accuracy.
w. Job Title - Indicate Job Title of Reviewer.
2. Page 2 information
a. Other Vehicle - Use this section if a third vehicle is involved. Provide driver and
vehicle information as indicated.
b. Private Vehicle Passengers - In the blocks provided indicate - Total number of
private passengers (non Augusta, Georgia employees); number of private passengers
taken to a hospital by ambulance and number of private passengers injured but not
take by ambulance.
c. Employee Passengers - List by name and department the Augusta, Georgia
passengers involved in the accident. In the boxes provided indicate whether they
were injured and/or transported by ambulance.
d. Conditions - Check the appropriate box/line for the conditions that were present at
the time of the accident.
i. Any claim of mechanical failure as a contributing factor to the accident will be
immediately report to Fleet Management and Risk Management.
e. Accident Description - Describe the accident in detail. Make sure you answer the
following questions when describing the accident - Who, What, When, Where,
How, Why. If more space is needed continue on a blank page. Pictures or a
drawing is encouraged.
Section 1000.118 Exceptions to Fleet Accident Report
Any Augusta, Georgia vehicle involved in an accident which results in a law enforcement officer filling
out a Georgia Motor Vehicle Accident report will not be required to have a Fleet Accident Report
submitted.
Section 1000.119 Witness Statements
A. Written statements will be obtained from the employee driver and any Augusta, Georgia
employee involved in the accident, as a minimum.
B. Prior to submitting the witness statement with the report, it will be reviewed for completeness.
Critical elements which should be answered in the statement are - Who, What, When, Where,
How.
C. Fleet Accident Reports are administrative investigations and as such employees involved are
obligated to cooperate in the investigation.
C. SAFETY TRAINING
Section 1000.201 General Safety Training
A. The effectiveness of a safety program is directly related to the quality of supervision, a
thorough understanding of the hazardous jobs to be accomplished, the training of employees,
and daily operations that consistently follow practices specified in published work rules.
1. New Employee Orientation. All new employees shall receive a safety orientation within the
first thirty days on the job. This will be accomplished during the "New Employee Briefing"
given to all new employees by the Human Resources Department and Risk Management. In
addition, supervisors will brief their employees on Department specific safety issues.
Appropriate documentation shall be maintained certifying completion of orientation on all
employees. Such documentation will be signed by the employee receiving orientation
training and the supervisor. The form located at RM-ANEO ± AUGUSTA, GEORGIA
Attachment number 2
Page 199 of 269
Item # 11
All Rights Reserved 200 | P a g e
NEW EMPLOYEE ORIENTATION will be used and when complete will be filed in the
individuals personnel file.
2. Employee Safety Training.
a. Training of employees in job responsibilities and job operations, proper methods and
techniques to be used, and the hazards associated with the function or system are
important elements in achieving safe operation. The emplR\HH¶VVXSHUYLVRUZLOOEH
responsible to assure that all newly assigned individuals receive adequate training
before beginning work. All training must be documented in writing and signed by
the employee, supervisor and trainer, if different from the supervisor.
b. Formal training is required for all employees engaged in hazardous operations such
as high voltage work, chemicals, pesticides, entering confined spaces and other
functions designated as hazardous by Risk Management, Department Directors, or
Supervisors.
c. Mandatory Repetitive Training - Form RM-MT ± MANDATORY TRAINING
3. On-The-Job Training. Training will be accomplished by supervisors and foreman
responsible for the individual. This training will include -
a. Safety program.
b. Prescribed Personal Protective Clothing and Equipment for the job.
c. Emergency treatment of injuries.
d. How to report a fire or serious injury and accident.
e. Specific hazards associated with the job.
f. General hazards encountered in the work area and how to avoid them.
4. No supervisor will assume that a newly hired, newly assigned, or reassigned employee
thoroughly knows all the safe job procedures.
5. If an employee demonstrates, through accidents or continued unsafe acts, that he does not
understand the safety requirements of his job, the employee will be retrained, repeat
on-the-MRELQVWUXFWLRQVDQGRUEHSHUVRQDOO\FRXQVHOHGE\WKHHPSOR\HH¶VVXSHUYLVRUDQGRU
department head.
Section 1000.202 Safety Training Specifics
A. The four point method (preparation, presentation, performance, and follow-up) has been found
best for all hazardous operations.
1. Preparation.
a. Put him/her at ease.
b. Define the job and find out what he or she already knows about the job.
c. Get him/her interested in learning his job.
d. Place him/her in the correct position for him/her to work.
2. Presentation.
a. Tell how, and illustrate one important step at a time.
b. Stress each key point.
c. Instruct clearly, completely, and patiently, but cover no more than can be mastered
each time.
3. Performance.
a. Have him/her do the job; coach him while he or she works.
b. Have him/her explain each key point to you as he or she does the job again.
c. Make sure he or she understands. Continue until you know he or she knows.
4. Follow-up.
a. Put him/her on his or her own.
b. Designate to whom he or she goes for help.
c. Check frequently; encourage questions.
Attachment number 2
Page 200 of 269
Item # 11
All Rights Reserved 201 | P a g e
d. Taper off extra coaching and close follow-up.
Section 1000.203 Specialized Training
A. Specialized training will be required from time to time for special areas of operation and to meet
specific requirements of unique tasks. These include special equipment, handling of weapons,
etc.
1. First Aid Training for Supervisors. All supervisors and selected employees are encouraged
to be trained in first aid. Many injuries can be effectively treated in the field, thereby
eliminating the need to visit a doctor for each minor injury. Adequate first aid material
should be made available and under the charge of a person trained in first aid.
2. Job Training - Hazardous Work. To eliminate accidents in high hazard areas, it is
mandatory that each supervisor thoroughly checks out his or her workers on the hazards that
exist and ensure that they understand the methods of doing each job safely when such
hazards cannot be eliminated.
a. Relying on memory alone during the instruction of an employee is assurance that
important items will be overlooked. It is essential that the supervisor use published
work rules which define each hazardous task his or her employees are responsible
for and define the correct work procedures for safe accomplishment of the task. This
enables them to attain a consistent quality of instruction that instills employee
confidence in their own capabilities and those of management.
b. Providing the employee with a copy of the work rules after instruction ensures that
he has a ready reference for his review. Procedures for job hazard analysis are as
follows - (Form RM-JTA ± JOB TASK ANALYSIS)
i. The job is broken down into basic steps. These steps describe what is to be
done and in what sequence. Details which have no bearing on the objective
are to be omitted.
ii. After the steps are listed, each step is analyzed for hazards that could cause
an accident. The purpose is to identify as many hazards as possible, whether
produced by the environment or connected with the mechanics of the job
procedure, so that each step of the entire job can be done safely and
efficiently.
iii. When the hazards and potential accidents associated with each step are
identified and their causes understood, ways of eliminating them shall be
developed. There are four ways in which this can be handled.
w. Eliminate the process of operations, or provide a substitute action
which can be done without the hazards, or
x. Isolate the process or operation so as to eliminate or minimize the
hazards, or
y. Provide guards or automatic devices to eliminate or minimize the
hazards, or
z. Provide personal protective clothing and equipment and enforce
their use to eliminate the possibility of injury.
iv. Using the information gathered from the first three steps, work rules shall be
written, disseminated among all employees, and maintained on file for
periodic review. This becomes a document to assist the supervisor in
instructing his employees in the safe method of performing their jobs and
determination of the personal protective clothing and equipment required. It
also provides each employee a source of information for occasional review.
Appendix 8 form may be used.
D. PERSONAL PROTECTIVE EQUIPMENT (PPE)
Attachment number 2
Page 201 of 269
Item # 11
All Rights Reserved 202 | P a g e
Section 1000.301 PPE General
Protective equipment, including personal protective equipment (PPE) for - eyes, face, head, extremities,
protective clothing, respiratory devices and protective shields and barriers, shall be provided by the
respective departments, used and maintained by the employee and kept in a sanitary and serviceable
condition. PPE shall not be altered in any way. Form RM-PPE establishes minimum PPE required of
common tasks.
Section 1000.302 PPE Responsibilities
A. DEPARTMENT DIRECTORS
1. Ensure PPE is available to employees involved in work requirements, which pose a potential
hazard through absorption, inhalation or physical contact.
2. Ensure supervisors are instructed in policies relating to the use of PPE by employees.
3. Charge supervisors with the responsibility of enforcing policies relating to the use of PPE.
B. Supervisors
1. Analyze job tasks to determine essential PPE.
2. Instruct employees on the tasks requiring PPE and the minimum PPE required for the task,
to include the proper use of protective equipment.
3. Enforce policies relating to the use of PPE by employees
C. Employee
1. Use PPE as directed by the supervisor or job task.
2. Identify any potential hazard of a job task, which PPE has not been identified and report it to
your supervisor.
Section 1000.303 General Safety Equipment
A. Eye and Face Protection - Protective eye and/or face equipment shall be required where there is
reasonable probability of injury that can be prevented by such equipment. Protection will be
made reasonably available and employees will use such protection. Eye protection will be
provided and used where machines or operation's present the hazard or potential for injury from
flying objects, or splashing liquids.
B. Respiratory Protection - Respiratory protection will be provided by the respective department to
control occupational diseases caused by breathing air contaminated with harmful - dusts, fogs,
fumes, mists, gases, smokes, sprays or vapors. The primary objective will be to prevent
atmospheric contamination. Respiratory protection will be provided to protect the health of the
employee. Product warning labels or material safety data warning labels or material safety data
sheets will prescribe the appropriate protection necessary for employee protection. Department
Directors are responsible for providing employee use and maintenance training as appropriate.
C. Occupational Head Protection - Helmets for the protection of heads from impact and penetration
from falling and/or flying debris or objects and from limited electrical shock and burn shall meet
the requirements and specifications of the American National Standard Safety Requirements for
Industrial Head Protection; Z89.1-1969. Within the departments, employees will be required to
wear protective helmets at:
1. Any construction site.
2. At any work location within 25 feet of a public road (including supervisors).
3. Grass cutting operations requiring tractor type mower with an open/unprotected driver
compartment.
4. Drivers of Augusta, Georgia vehicles, with enclosed driver compartments are not
required to wear protective helmets unless they exit the vehicle in an area or operation
described above. Departments may designate specific colors for specific levels of
Attachment number 2
Page 202 of 269
Item # 11
All Rights Reserved 203 | P a g e
workers (i.e. - workers - orange helmets, supervisors - white helmets, etc.). In all cases
green helmets are designated as safety personnel.
D. Foot Protection - Safety toe footwear shall meet the requirements and specifications established
in the American National Standard for men's Safety Toe Footwear Z41.1 - 1967.
E. Visibility Vests -
1. The non-reflective orange or other appropriate safety vest shall be used by all
employees involved in construction operations, repair operations, or other official duties
within 25 feet of a public road and when operations are conducted in unlimited visibility.
The traffic orange shirt may be used in place of the non-reflective vest provided it is the
outer most garment.
2. Employees on or within 50 feet of a public road will use the reflective orange/silver vest
and when visibility is limited (fog, rain, dusk, night). This includes (but not limited to)
construction, repair operations, traffic control, accident investigation or meter reading.
3. Vests will be periodically inspected to ensure serviceability.
Section 1000.304 Minimum Essential Requirements
A. Departments are responsible for determining minimum essential requirement for PPE. Risk
Management will be informed of minimum essential requirements for PPE using the form at
Form RM-PPE.
B. Form RM-PPE establishes minimum essential requirements for specific tasks which are either
common to more than one department or specific requirements which have, in the past resulted
in needless employee injury.
1. The Job Hazard Analysis is to be used for specific jobs. When completed, may be used
as a policy/procedure within the department. ±RM-JTA JOB TASK ANALYSIS
2. Once the job or task to be analyzed is determined, the steps or procedures are listed
individually in the Job Steps column.
3. Each step is then analyzed for potential hazards associated with that step; these are listed
in the Potential Hazards column.
4. List the activities to be accomplished to a complete the job step and include any activity
or action to eliminate the hazard, in the "Prevention" column.
Section 1000.305 Employee Non-Compliance/Non-Use of PPE
Once an employee is trained in the use of personal protective equipment and clothing, if such items are
not used the employee's supervisor will take immediate corrective and/or disciplinary action.
Supervisors should document corrective action and if necessary discipline the employee as appropriate.
Failure to use proper clothing and equipment could result in suspension or termination, as appropriate.
Supervisors should document any action taken against the employee. Should an employee become
injured as a result of not wearing prescribed personal protective equipment, he/she may be denied
compensation under Workers Compensation.
Section 1000.306 PPE Funding
A. When PPE has been determined a requirement of the job based on the POTENTIAL for injury,
Augusta, Georgia will provide such PPE, as required, at no cost to the employee.
1. Employees who lose or negligently damage or destroy PPE will be responsible for the
replacement of those items.
2. Items will be replaced when equipment is no longer serviceable. Footwear will be replaced
at one pair per year.
Attachment number 2
Page 203 of 269
Item # 11
All Rights Reserved 204 | P a g e
E. SAFETY REVIEW COMMITTEE (SRC)
Section 1000.401 Declaration
There is hereby created a body known as the "Safety Review Committee", hereafter referred to as SRC.
Section 1000.402 SRC Purpose
A. To review all vehicle accidents involving Augusta, Georgia vehicles to determine cause.
B. To review all property damage or incidents resulting in loss, damage, or destruction to Augusta,
Georgia property in excess of $1,000.00.
C. To review all incidents resulting in claims, torts or loss by liability to Augusta, Georgia; as it
applies to property damage, loss or destruction of property and/or resulting in bodily injury to an
employee due to legal and expected operations of subordinate departments of the Augusta,
Georgia.
D. To review all reported injuries to employees during the course of their employment under the
provisions of Workers Compensation.
Section 1000.403 SRC Membership
A. One supervisory member of the Sheriff's Department holding the rank of major or below.
B. One supervisory member of the Fire Department holding the rank of captain or below.
C. One member of the Utilities Department serving as a first line supervisor or at the administrative
level (office manager).
D. One member of Public Works holding the rank between Superintendent and Foreman.
E. One member of the Recreation Department serving as a first line supervisor or administrative
management level.
F. One representative of the Transit Department who serves as a first line supervisor or at the
administrative level.
G. One representative of the Marshal's Department holding the rank of captain or below.
H. One supervisory representative of RCCI holding the rank of Lieutenant or below.
I. One supervisory/safety officer representative of Augusta Regional Airport.
J. Risk Management Manager shall serve as the Chairperson and shall vote only in the event of a
tie vote.
K. Department Directors or Elected Officials of members listed in the above membership listing
shall appoint an alternate member to serve in the absence of primary member.
Section 1000.404 Member Tenure
A. Appointments of members shall be for a period of two years unless rescinded by the appointing
authority.
B. The departments listed below shall review their appointee the first working day of January of
each even numbered year (i.e. - 1996, 1998, 2000...) and notify Risk Management in writing of
the primary and alternate member.
1. Sheriff's Office
2. Utilities Department
3. Recreation Department
4. RCCI
Attachment number 2
Page 204 of 269
Item # 11
All Rights Reserved 205 | P a g e
5. Augusta, Georgia Regional Airport
C. The departments listed below shall review their appointee the first working day of January of
each odd numbered year (i.e. - 1997, 1999, 2001...) and notify Risk Management in writing of
the primary and alternate member.
1. Marshal's Office
2. Public Works - Roads & Bridges
3. Fire Department
4. Transit Department
Section 1000.405 Definitions
A. Damage Assessment - A monetary forfeiture assessed against an employee found to be at fault
as a result of conduct which results in a loss to the Augusta, Georgia.
B. Gross or Willful Negligence - an intentional unreasonable act by an employee knowing the
conduct will result in property damage or injury (i.e. - throwing a radio on the ground,
provoking or starting a fight). Where the employee initiates or executes the act, knowing the
possible results of his or her actions but does not care.
C. Negligence - Conduct that falls below the standard set by law or policy for protecting others
against risk or harm. A person is negligent if he/she fails to act with a reasonable amount of
care and as a result injures another person or thing. The following criteria applies ±
1. The person has a legal duty or obligation to conform to a certain standard of conduct to
protect others or property against unreasonable risk.
2. The person failed to conform to that standard.
3. The persons conduct is so closely related to the resulting injury or damage that it can be
said to have caused it (proximate cause).
4. Actual damage (property or injury) results from the persons conduct.
D. Proximate Cause - Conduct which is the primary cause from which an injury or damage
follows as a direct or immediate consequence and without which the injury or damage would
not have happened.
Section 1000.406 Authority
A. The SRC shall be empowered to ±
1. Investigate any and all accidents/incidents involving employees, occurring in the course
of their employment, and/or equipment which results in personal injury or property loss
or damage.
2. Investigate any accidents/incidents occurring on Augusta, Georgia Property.
3. Investigate and review all personal injury accidents and Workers Compensation claims
and all records and information to the same.
4. Make recommendations to policy, to any department subordinate to the Augusta,
Georgia through Risk Management Committee on matters pertaining to ±
a. Fleet Management/Maintenance,
b. Safe work practices,
c. Loss prevention/security,
d. Claims/tort reduction
5. Levy monetary damage assessments against employees found to be at fault in vehicle
accidents or incidents resulting in property damage
6. The SRC has the DXWKRULW\ WR WHUPLQDWH DQ HPSOR\HH¶V GULYLQJ SULYLOHJHV DV
recommended by the Point Matrix. The SRC can recommend to the department courses RIDFWLRQLIGULYLQJLVDPDMRUIXQFWLRQRIWKHHPSOR\HH¶VMREUHVSRQVLELOLWLHV
7. Recommend disciplinary action up to and including discharge of employment or
suspension of an employee for ±
Attachment number 2
Page 205 of 269
Item # 11
All Rights Reserved 206 | P a g e
a. Gross negligence which results in losses to the Augusta, Georgia
b. Repeated safety violations (complete documentation is required),
c. Accumulation of maximum penalty driving points for driver error (see RM-SRC-
PM ± PENALTY MATRIX). Most employees are terminated for loss of job
requirement, those who are not terminated but moved to another position the
following would apply - due to liability issues, when an employee reaches the
maximum points allowable in a 3 year period their driving privileges are revoked
and cannot be reinstated in the future, most employees are terminated from
employment for the loss of job requirement.
d. Failure to pay damage assessments adjudged by the SRC and upheld by the Risk
Management Committee.
8. Review and make recommendations pertaining to all matters relating to motor vehicle
and general safety relative to Augusta, Georgia owned vehicles, equipment and
employees.
9. To direct the attendance of employees as it shall deem appropriate for the proper
determination of the facts surrounding each accident and obtain such documentary
evidence as shall be needed to complete its investigation.
Section 1000.407 Penalties
A. A standard point system will be used for all vehicle violations to insure all employees are treated
HTXDOO\7KLVSRLQWV\VWHPLVQRWDVVRFLDWHGZLWKWKH*HRUJLDGULYHUV¶SRLQWV\VWHP
B. Any department disciplinary action taken against the employee will be reported to Risk
Management and Human Resources and will be made a part of the accident and personnel
record.
C. The SRC will take into consideration any and all disciplinary action taken by the department
against the employee and make adjustments to penalties as appropriate.
D. PENALTY MATRIX ± Form RM-SRC-PM describes the categories of accident violations and
penalties. When an employee is involved in an AT FAULT accident/incident, which results in
property damages less than $1105.00, the Committee may elect to set aside any penalties for 6
months.
1. If the employee is not involved in an AT FAULT accident/incident for that period of WLPHWKHHPSOR\HH¶VUHFRUGZLOOEHSXUJHGRIWKH$7)$8/7UXOLQJ
2. If the employee is involved in an AT FAULT accident/incident within that time, the
incident will remain a part of the employee's record. Penalties, which were originally set
aside, would take effect.
Section 1000.408 Procedures
A. Departments will report all vehicle accidents, damage to vehicles, equipment or property using
either the Fleet Accident Report or Incident Report unless a report is made by a law
enforcement official.
B. All reports of accidents or incidents will be forwarded to Risk Management within 24 hours.
1. Reports requiring additional time for investigation will be telephonically reported to
Risk Management.
2. Reports will include witness statements from any employee involved.
C. All reports will be logged by Risk Management and scheduled for the Safety Review
Committee.
D. Employees will be notified by letter that their accident/incident will be reviewed by the SRC
giving the date, time and location of the SRC.
1. Any employee directly involved in the accident/incident has the right to appear before
the SRC.
Attachment number 2
Page 206 of 269
Item # 11
All Rights Reserved 207 | P a g e
2. Employees desiring to have witnesses speak in their behalf should contact Risk
Management prior to the scheduled meeting date giving the name, department and
relationship to the accident/incident of the witness. Only witnesses with first hand
information will be allowed.
3. Risk Management will notify the appropriate department of witnesses to attend.
4. Employees not able to attend the scheduled meeting may request a delay by notifying
Risk Management and giving the reason.
5. No one may deny the employee the right to appear before the SRC. Supervisors or
DEPARTMENT DIRECTORS may request a delay for the employee based on
operational necessity but must notify Risk Management of the request.
E. Employees should be present at the scheduled time and place. Once called, the employee will
provide information as requested by the SRC, usually an explanation of the accident/incident.
1. Prior to the meeting the employee should review any documentary evidence, such as the
Fleet Accident Report, Incident Report and/or vehicle accident report filed by the
investigating law enforcement agency. THIS REVIEW IS THE RESPONSIBILITY OF
THE EMPLOYEE
a. Fleet Accident Reports and Incident Reports may be obtained from the
employee's department or by calling Risk Management at 821-2301.
b. Law enforcement reports may be obtained from Risk Management.
c. Employees who feel the police report is inaccurate should attempt to have the
report corrected with the appropriate law enforcement agency prior to the Board
meeting.
F. The SRC will review each accident/incident to determine WKHHPSOR\HH¶VDFWLRQVWREHHLWKHU$7
FAULT or NOT AT FAULT. Penalties for employees found AT FAULT will be assigned in
accordance with Form RM-SRC-PM
G. Employees will be notified by letter of the outcome of the review. The letter will inform the
employee found AT FAULT of the penalty ruled by the SRC. Employees who have been given
a damage assessment by the SRC may pay by cash, check or payroll deduction using the form at
RM-SRC-PARSRCDA ± PERSONNEL ACTION REQUEST SRC DAMAGE
ASSESSMENT. Persons wishing to use payroll deduction should notify Risk Management.
Minimum deductions are established by the Accounting Department if cash payment is desired.
H. Minutes of the SRC meeting will be prepared by Risk Management and forwarded to Risk
Management Committee for review.
Section 1000.409 Appeals
A. Any employee whose case has been acted upon by the SRC has the right to appeal.
B. Appeals will be made to Risk Management Committee. Appeals must be submitted to Risk
Management within 10 days of receipt of notification, in writing, that the Safety Review
Committee has found the employee at fault. The employee may notify Risk Management by
telephone or in writing.
C. Appeals may be requested for ±
1. Reconsideration with no new information.
2. Reconsideration with new information.
3. Appeal as a result of financial hardship.
D. Appeal Process
1. The employee will contact (by phone, in person or in writing) Risk Management of his
or her desire to appeal and the reason for the appeal.
2. If the appeal is made because of new information, which was not available to the SRC at
the initial ruling, the Chairperson of the SRC may elect to have the case returned to the
SRB for reconsideration rather than to Risk Management Committee. Should the SRC
Attachment number 2
Page 207 of 269
Item # 11
All Rights Reserved 208 | P a g e
not change their initial ruling the request is forwarded to Risk Management Committee.
3. Appeals as a result of financial hardship must be supported by documentation by the
employee. Failure to provide financial documentation may result in denial of the
appeal.
Section 1000.410 Employee Files
A. Any employee involved in an accident/incident resulting in property damage will have a file
maintained in Risk Management. The file will consist of ±
1. Any report of loss which the employee is directly involved in.
2. Any witness statement available concerning the accident/incident.
3. Any documentation - invoices, estimates, pictures or allied documents pertaining to the
incident.
B. On the inside cover of the employee record an incident summary will be annotated with the date
of incident, SRC ruling, and penalties assigned.
C. Entries will be purged (lined through) to ensure only incidents within the past 3 years remain
active.
D. Points, which have been accumulated, remain effective for 3 years, for the purpose of SRC
rulings on penalty adjustments.
E. Employees have the right to review their files by contacting Risk Management.
F. Employee records will be maintained as active records as long as they are employed by the
Augusta, Georgia.
G. Records will be moved from the active file to inactive file when the employee is terminated or
resigns. This file will be retained for 7 years after the last incident, at which time the complete
file will be destroyed.
Section 1000.411 Employee Point System
A. Employees who are found AT FAULT by the Safety Review Committee may be awarded
administrative points for damage, loss or destruction to property or for causing vehicle accidents
or causing property damage.
B. Points will accumulate for a period of 3 years at which time they will "roll off". The points are
used as a method to evaluate the risk potential of an employee. The more points that
accumulate during a three year window, the higher the risk the employee is to their department
and to public safety.
C. As a deterrent to reckless job performance by the employee, the emplR\HH¶V SRLQWV
accumulation could lead to disciplinary action by DEPARTMENT DIRECTORS as indicated
below, this is in addition to action taken by the Safety Review Committee -
1. 5 to 8 points ± Written Reprimand
2. 9 to 11 points ± 3 Day Suspension
3. 15 points - terminate
F. RISK MANAGEMENT COMMITTEE (RMC)
Section 1000.501 Declaration
There is hereby created a body known as the "Risk Management Board" hereafter referred to as RMC.
The department will respond in writing to the recommendation made by Risk Management Committee
outlining what action will be taken concerning the recommendation and what date the action will be
taken.
Attachment number 2
Page 208 of 269
Item # 11
All Rights Reserved 209 | P a g e
Section 1000.502 RMC Membership
A. Chairperson - Director, Finance Department (Votes to break tie votes)
B. Co-chairperson - Risk Management Manager (Nonvoting Member)
C. Chief Deputy of Administration - Sheriff's Department (Member)
D. Battalion chief or higher- Fire Department (Member)
E. Warden - RCCI (Member)
F. Assistant Director Public Works (Member)
G. Superintendent - Utilities (Member)
H. Director of Recreation (Member)
I. Workers' Compensation Coordinator (serves as Secretary - Nonvoting)
Section 1000.503 Objectives
A. To review all decisions of the Safety Review Committee and serve as the appeal board in which
employees may appeal decisions rendered by the Safety Review Committee.
B. To recommend new and revised policies and procedures for Risk Management Safety manual.
C. To develop a two year plan of action to reduce Workers' Compensation costs, reduce property
loss, and eliminate exposures to liability through loss control prevention.
D. To develop a mission statement conducive to the commitment of providing a safe working
environment to all employees.
E. Review all liability losses incurred and make recommendations on how to prevent a
reoccurrence.
F. Make recommendations to appropriate department management as to disciplinary action(s) to be
taken for employees proven to violate rules set forth in Risk Management Manual. Disciplinary
recommendations may be oral warnings, written warnings, suspensions, and termination of
employment.
G. Make recommendations to any department concerning loss control-prevention. These
recommendations will be in writing and submitted to the highest level of management
G. WORKERS COMPENSATION
Section 1000.601 Purpose
A. The Workers Compensation policy is established to provide procedures, guidance and
information for the medical care of employees who are injured "in the course of their
employment". All aspects of Workers Compensation are governed as a matter of Georgia law.
B. The purpose of this policy is to provide to all Augusta, Georgia employees a guideline relating
to the administration of Workers' Compensation benefits, and to outline their obligation under
the Georgia State Workers' Compensation law.
C. Nothing in this policy shall or is intended to conflict with the Georgia State Workers'
Compensation law. In the event any information of this policy is in conflict with the law the
law prevails. Any questions of the application of the Worker's Compensation Law or
interpretation of this policy shall be immediately addressed to Risk Management.
Section 1000.602 General
A. By law the Augusta, Georgia is required to provide Workers' Compensation benefits to its
employees. Augusta, Georgia has elected to Self-insure this program.
B. Program administration is the responsibility of Risk Management who may use the services of
an independent claim handling Service.
Attachment number 2
Page 209 of 269
Item # 11
All Rights Reserved 210 | P a g e
C. It is the INTENT of the Augusta, Georgia to comply in all regards with the Worker's
Compensation law of the State of Georgia.
D. Any employee involved in an accident which results in him or her requiring and/or receiving
medical treatment for injuries will be tested for illegal substances.
Attachment number 2
Page 210 of 269
Item # 11
All Rights Reserved 211 | P a g e
Section 1000.603 Definitions
A. WORKERS' COMPENSATION LAW - The State of Georgia law that requires that Augusta,
Georgia provide and pay certain benefits on behalf of or to an employee - who is injured by an
accident which arises out of or during the course of his or her employment, or who suffers an
occupational disease as defined in the law.
B. EMPLOYEE - Any individual (other than elected officials and employees of Independent
Service Contractors) employed by the Augusta, Georgia. This includes - full-time employees,
part-time employees and temporary employees hired and paid directly by the Augusta, Georgia.
C. COMPENSABLE INJURY OR DISEASE - Any injury by accident which arises out of or
during the course of employment or an occupational disease as defined in the State of Georgia
Workers' Compensation Law.
D. WORKERS COMPENSATION BENEFITS -
1. Benefits as defined in the Workers' Compensation Law which pay for lost income and
medical services directly resulting from a compensable injury or disease.
a. The first seven calendar days are not payable unless the employee is out over
twenty-one calendar days. If available, accrued leave will be used for the first seven
days.
b. Two thirds of the employees' average gross wages will be paid up to maximum
benefit per week as allowable by State law.
c. Compensation for certain line-of-duty injuries of law enforcement officers, firemen,
and employees of the corrections department will be in accordance with the
Personnel Policies and Procedures Manual.
E. DISABILITY - The inability of an injured employee to return to suitable work which is a
direct result of his or her compensable injury or disease and is supported by an authorized
treating physician.
F. PANEL OF PHYSICIANS - The list of four or more physicians chosen by Augusta, GA to
provide medical services to employees who sustain a compensable injury or an occupational
disease.
G. AUTHORIZED TREATING PHYSICIANS - The list of four or more physicians chosen by
Augusta, Georgia to provide medical services to employees who sustain a compensable injury
or an occupational disease.
H. GEORGIA STATE BOARD OF WORKERS' COMPENSATION - The State Board that is
authorized by law to administer Workers' Compensation matters. The Board is empowered to ±
1. Make and enforce rules and regulations;
2. Hold hearings concerning disputed issues;
3. Assess penalties for non-compliance and approve settlements of disputed issues.
Section 1000.604 Responsibilities
A. Department Directors
1. Insure that employees and supervisors follow correct procedures for filing job related
accident reports and injury.
2. Insure that supervisors investigate all accidents and report all injuries or alleged injuries,
and take the appropriate steps to provide the necessary medical care to treat the
compensable injury.
3. Conduct your own investigation and where necessary take appropriate steps to insure the
cause of the accident is corrected as soon as possible to prevent a recurrence.
4. Report immediately any concerns relating to the accident or injury to Risk Management.
Attachment number 2
Page 211 of 269
Item # 11
All Rights Reserved 212 | P a g e
B. Immediate Supervisors
1. Insure that the injured employee is provided with first aid treatment or if necessary is
provided with emergency medical care.
2. File a First Report of Injury with the Risk Management Department within 24 hours
after being made aware that a job related accident/injury has occurred or is being
alleged.
3. Report by phone immediately any accident involving a serious injury and/or serious
injury and/or death.
4. Thoroughly investigate the accident or alleged accident and includes the results of the
investigation in the First Report of Injury. If all information is not available the report
may be submitted as an initial report by marking the appropriate box on the form.
5. If an employee is not able to return to work, will periodically check on the employee by
telephone to inquire about the employee¶s recovery. This will be done on a daily basis.
Contact Risk Management to advise them of the HPSOR\HH¶V condition and progress.
C. Employees
1. Report all accidents and/or injuries, regardless of how trivial, to his or her immediate
supervisor as soon as the injury occurs. If the injury prevents an immediate report, the
employee must report the injury AS SOON AS POSSIBLE or have someone do so on
the employee¶s behalf.
2. Those employees who are witnesses to a job related injury must fill out a witness
statement.
D. Risk Management
1. $GPLQLVWUDWHVDOOSKDVHVRIWKH$XJXVWD*HRUJLD
V:RUNHU¶V&RPSHQVDWLRQ3URJUDP
a. Ensure that all employees, supervisors and department directors comply with
procedures UHODWLYHWR:RUNHU¶V&RPSHQVDWLRQGLUHFWRUVFRPSO\ with procedures
relative to Worker' Compensation.
b. Continuously monitor all phases of the Workers' Compensation Program to
ensure complete compliance with the State Law and compliance with the
purpose and intent of this Policy.
2. Make recommendation and/or approve any additions to or changes related to the panel
of authorized physicians.
3. Make recommendations and/or approve any additions to or changes of the Policy and
Procedure Manual.
4. Is the only approving authority for medical treatment covered under Workers
Compensation.
Section 1000.605 Emergency Procedures
A. Supervisors
1. Seek immediate medical services for the injured employee.
2. Inform the emergency room staff that the injured employee is an Augusta, Georgia
employee and request that follow-up care be referred to a panel physician after
emergency treatment has been performed.
3. Inform the department head and Risk Management of the accident as soon as possible
and complete and file an accident investigation report within 24 hours.
Section 1000.606 Non-Emergency Procedures
A. Employee reports the injury to his or her immediate supervisor as soon as possible but no later
than the end of the day's shift.
B. Supervisor and/or department head assist the employee in receiving medical treatment from a
panel physician, or if appropriate on weekends, holidays or nights from an emergency room.
Attachment number 2
Page 212 of 269
Item # 11
All Rights Reserved 213 | P a g e
C. If appropriate the supervisor and/or the department head should accompany the injured
employee to the physician's office or emergency room.
D. Provide the injured employee with an ORDER FOR WORKERS' COMPENSATION
MEDICAL TREATMENT Form RM-WCMT be presented by the employee to the authorized
treating physician. The employee should return the completed form to the supervisor after
visiting the physician.
E. If an employee is referred to a panel physician and then to a specialist for follow-up treatment,
the specialist becomes the authorized treating physician.
Section 1000.607 Clearance to Return to Work
A. For minor injuries treated at an emergency room the employee is expected to return to work as
soon as the treatment has been given.
B. For injuries treated by a panel physician or a referral specialist, the authorized treating physician
will make a medical determination of the employee's return to work status and will give the
employee a written slip to be given by the employee to his supervisor or department head.
Section 1000.608 Workers Comp Temporary Duty Purpose
A. The purpose of the Temporary Duty Program is to temporarily place employees who have
sustained work-related injuries, in positions consistent with the medical restrictions
prescribed by an authorized treating physician. Ideally, the employee will work within his or
her own department. However, it may become necessary to place the employee in another
department or shift to accommodate their medical needs.
B. The goal of the program is to promote psychological recovery and to minimize lost time by
encouraging appropriate levels of activity for injured employees.
C. Risk Management will be responsible for administering the Temporary Duty Program.
Section 1000.609 Workers Comp Temporary Duty General Guidelines
A. Departments may request temporary duty assistance by submitting the Request for
Temporary Duty Assistance to Risk Management.
B. Departments should be innovative in developing and assigning meaningful tasks which will
allow the employee to utilize his or her experience, education and physical capability.
C. The temporary duty employee's home department is responsible for all expenses associated
with the employee for the duration of their temporary duty status.
D. It is the responsibility of the employee to adhere to the temporary limitations identified by his
or her authorized treating physician.
E. The supervisor of the assigned department is responsible for ensuring that employees in
temporary duty assignments work within the identified medical restrictions.
F. The employee's work schedule, leave, etc., will be coordinated by the supervisor of the
assigned department.
G. The supervisor of the temporary duty employee will be responsible for submitting time
sheets to his or her home department. If the employee is assigned to more than one
department, the supervisor from each department must submit a time sheet to the employee's
home department.
H. The supervisor of the assigned department will be responsible for completing the Temporary
Duty Employee Performance Evaluation , which will be used to support the employee's
personnel evaluation. The evaluation form is required only if the employee is assigned
temporary duty under a different supervisor.
Attachment number 2
Page 213 of 269
Item # 11
All Rights Reserved 214 | P a g e
I. The duration of the temporary duty assignment may range from one day to a maximum of
twelve weeks, unless otherwise approved by Risk Management. Temporary duty assignments
may be used in conjunction with FMLA.
Section 1000.610 Workers Comp Temporary Duty Assignment
A. Once the physician assigns an employee to temporary duty status, the employee must submit
a copy of the Physical Capacity Evaluation Form to Risk Management (via fax). The
employee or the employee's supervisor may call Risk Management the next working day for
a temporary duty assignment. Exceptions would be those employees who are capable of
performing in their regular duty assignment or department, with accommodations being made
by their home department.
B. Risk Management, under the advisement of the adjuster, authorized treating physician and/or
rehabilitation professional, will assign the employee to a temporary position which meets the
employee's medical restrictions. Consideration will be given to the employee's home
department, assignment, shift, etc. However, if temporary duty cannot be arranged within the
employee's home department, the employee will be assigned to a different department, if
available.
C. The temporary duty employee has an obligation to adhere to the policies of the assigned
department. If the employee's work habits are not conducive to the overall effectiveness of
the assigned department, then the assigned supervisor may request that the temporary
employee be placed elsewhere. This request must be submitted to Risk Management in
writing.
D. If an employee chooses not to work in an assigned temporary duty position within the
medical restrictions prescribed by the authorized treating physician, then indemnity benefits
will not be paid.
E. Risk Management is responsible for notifying the employee's home department of the
employee's temporary placement and providing updates regarding changes in the employee's
medical restrictions.
Section 1000.611 Returning to Full Duty from Workers Comp Temporary Duty
A. Once the authorized treating physician releases the employee to full duty, the employee must
return to his or her home department with the Return to Work authorization. The home
department is responsible for notifying Risk Management before the next working day by
faxing a copy of the Return to Work authorization. Risk Management will inform the
assigned department of the employee's change in work status.
B. Worker's compensation law does not require the Augusta, Georgia to hold the injured
employee's position until he/she can return to work. Employees' whose injury constitutes a
"serious health condition" as defined in the Family and Medical Leave Act (FMLA) and is on
leave will be placed on FMLA for up to twelve weeks. If an employee is unable to return to
full duty at the end of FMLA, a maximum of twelve weeks of temporary duty will be offered
to transition the employee back into the workplace. Employees ineligible for FMLA will be
granted up to twelve weeks of temporary duty.
C. While assigned to temporary duty, Risk Management will obtain status reports from the
authorized treating physician. If the physician determines that the employee is unable to
return to his or her permanent position, Risk Management will request that a rehabilitation
professional perform a job accommodation analysis or a transferable skills analysis. Based on
this analysis, the Augusta, Georgia will assist the employee with obtaining a position which
meets his or her skill level and medical limitations.
D. In the event the employee's permanent restrictions meet the ADA requirements, the Augusta,
Georgia, upon the employee's request, will make reasonable accommodations for the
Attachment number 2
Page 214 of 269
Item # 11
All Rights Reserved 215 | P a g e
employee's placement based on a job accommodation analysis performed by rehabilitation
professional.
E. If Augusta, Georgia cannot accommodate employees who have received permanent
restrictions, Human Resources will work in collaboration with Risk Management and a
rehabilitation professional to determine a position which is appropriate for his or her skill
level and medical limitations.
Section 1000.612 Workers Comp Temporary Duty Definitions
A. ADA - American with Disabilities Act - a civil rights bill giving individuals with disabilities
protection from discrimination in employment and in access to commercial facilities,
transportation, telecommunications, and state and local governmental services.
B. Assigned Department - department where injured employee is placed pending full medical
release to job of injury.
C. Authorized Treating Physician - physician who is authorized under the Augusta, Georgia's
Panel of Physicians to provide treatment to Augusta, Georgia employees.
D. Primary Department - department in which employee was hired. In most instances, the
department where the employee worked at time of injury.
E. Indemnity Benefits - cash benefits paid to an injured worker to replace part of wages lost as a
result of a work injury.
F. Job Accommodation Analysis - an analysis of a position which attends to any specific work
station modification that would allow someone to do their job.
G. Rehabilitation Professional - person certified and approved by the State of Georgia in the
field of disability management.
H. Return to Work Authorization - written authorization, from the authorized treating physician,
allowing the injured employee's return to duty.
I. Temporary Duty Assignment - temporary job assignment which meets the medical
restrictions as prescribed by the authorized treating physician. Assignment is not to exceed
24 weeks.
J. Transferable Skills Analysis - an analysis of the injured employee's past employment skills
which would allow a transfer to new employment.
K. Physical Capacity Evaluation Form - notification from the authorized treating physician
which outlines the medical limitations of the injured employee.
Section 1000.613 Workers Comp Temporary Duty Forms
A. Request for Temporary Duty Assistance Form
B. Temporary Duty Employee Performance Evaluation Form
Attachment number 2
Page 215 of 269
Item # 11
All Rights Reserved 216 | P a g e
CHAPTER XI.
OTHER RISK MANAGEMENT RELATED POLICIES
A. CLAIMS ADMINISTRATION
Section 1100.001 Claims Administration Purpose
To establish policy, procedures and guidance in response to claims, torts, potential law suits or any
allegations of damage or injury by employees or equipment belonging to, or under contract by Augusta,
Georgia.
Section 1100.002 General Claims Administration Policy
A. No person employed by the Augusta, Georgia will accept responsibility for damages or injury to
persons or property owned by the general public.
B. All incidents of damage to property or equipment or injury to the general public will be reported
to Risk Management by telephone, and followed up with the Augusta, Georgia Incident Report
(Form RM-AGIR) or Fleet Accident Report (Form RM-FAR).
C. Any employee knowing of an incident (injury or damage) which involves an employee or
equipment of Augusta, Georgia and the general public will report the incident immediately.
D. Damage to Augusta, Georgia equipment or property will be reported to supervisors at the
earliest opportunity. This includes acts of vandalism and theft.
E. Injuries received during the course of employment will be reported and the procedures for
Workers Compensation will be followed.
F. Any incidents of theft will be reported to the appropriate law enforcement agency as well as
following the procedures of this section.
G. Risk Management will not accept claims from employees for the loss, theft, damage or
destruction of personal property not directly related to Augusta, Georgia operations.
Section 1100.003 Claims Administration Responsibilities
A. Risk Management - Serves as the primary department under the Augusta, Georgia for
processing claims, torts, settlements and law suits against Augusta, Georgia and its subordinate
departments.
B. Department Directors -
1. Establish procedures for the reporting of all claims of ±
a. Property damage, loss or theft of Augusta, Georgia owned property;
b. Damage to property owned by the general public;
c. Injury to the general public by Augusta, Georgia equipment, personnel or injury to the
general public within Augusta, Georgia facilities.
2. Notify Purchasing Department of any Augusta, Georgia equipment that is lost through
damage or theft, specifically ±
a. Property with an asset number;(See Fixed Asset Policy; February 7, 1995)
b. Property with a serial number;
c. Any communication type equipment;
d. Any media type property (i.e. cameras, TVs, radios, stereos, projectors);
e. Computer/word processor type equipment;
f. Equipment under lease or contract;
g. Machinery/power tools;
h. Property valued in excess of $99.00, which is not by its nature expendable.
3. Ensure supervisors are familiar with reporting responsibilities/procedures.
Attachment number 2
Page 216 of 269
Item # 11
All Rights Reserved 217 | P a g e
4. Implement necessary policies to reduce loss or injury.
Section 1100.004 Claims Administration Procedures
A. Any employee having knowledge of an incident involving Augusta, Georgia property or
operations which could lead to a claim against the Augusta, Georgia will report the incident to
their supervisor as soon as possible.
B. A telephonic report will be made by the designated department representative to Risk
Management, as information only, on any injuries to the general public with implications of
Augusta, Georgia involvement. A written report should be completed and forwarded within 24
hours of the incident.
C. An Augusta, Georgia Incident Report (Form RM-AGIR) or Fleet Accident Report (Form RM-
FAR) will be completed and forwarded to Risk Management within 24 hours of the incident. If
the department investigation is not complete within the prescribed time, the department
representative should contact Risk Management.
D. Recovery/replacement of department losses will be coordinated through Risk Management.
E. Risk Management will replace lost, stolen, or damaged equipment (no vehicle) on a case by
case basis. Generally replacement is limited to department equipment if the equipment is
essential to the whole departments operation.
B. HOUSEKEEPING
Section 1100.101 Housekeeping Policy Overview
It is the intent of Augusta, Georgia to provide for a safe work environment. To this end work sites shall
be constantly monitored by supervisors and foreman to ensure potential hazards to employees and the
general public are reduced to the maximum extent possible. Employees will be required to keep their
work areas picked up and free of hazards.
Section 1100.102 Housekeeping
Good housekeeping is an important element of accident prevention. It should be of primary concern to
all supervisors and foremen. Good housekeeping should be planned at the beginning of the job and
carefully supervised and followed to the final clean-up. Housekeeping should be the concern of each
worker and not left for the clean-up crew. Confusion will be reduced and operations will be more when
the work area is neat and orderly at all times.
Section 1100.103 Housekeeping Procedures
A. Plan Ahead - A materials storage area which has been planned is safer and cleaner than one
which has been developed haphazardly.
B. Assign Responsibilities - If the size of the job and working force merits, a crew should be
specifically detailed to clean up continuously. In any event, housekeeping should not be
haphazard; duties should be assigned to one or more responsible persons.
C. Implement the Program - Housekeeping should be part of the daily routine with clean-up
being a continuous procedure.
Section 1100.104 Rules for Housekeeping
Attachment number 2
Page 217 of 269
Item # 11
All Rights Reserved 218 | P a g e
A. Storage Areas - All materials should be maintained in neat stockpiles for ease of access.
Aisles and walkways should be kept clear of loose materials and tools.
B. Work Areas - Loose materials, waste, etc. should be cleaned up immediately. This is especially
important in aisles and in the vicinity of ladders, ramps, stairs, and machinery.
C. Areas Used by Personnel - Empty bottles, containers, and papers should not be allowed to
accumulate where lunches are eaten on the job site. Trash disposal cans should be provided.
D. Oil and Grease - Spills of oil, grease, or other liquid should be removed immediately or
sprinkled with sand or an oil absorbing compound.
E. Disposal of Waste - An effective means of preventing litter is the provision of suitable
receptacles for waste, scrap, etc. should be stored in a safe place, such as a covered metal
container, and disposed of regularly.
F. Protruding Nails - Protruding nails should either be removed or bent over. This should be done
as this hazard develops. Cleaned lumber should be stacked in orderly piles. Workers
performing this task should wear heavy gloves and puncture proof insoles.
G. Lighting - Adequate lighting should be provided in or around all work areas passageways,
stairs, ladders, and other areas used by personnel.
H. Defective Equipment - All equipment, especially electric cords and plugs, should be checked
and defects reported.
I. Tripping Hazards - Loose floor covering, stair treads, etc., should be examined and repaired
immediately.
C. SAFETY INSPECTIONS
Section 1100.201 Safety Inspections
Department Directors shall require the department safety officer to make monthly safety inspections of
the work activities and facilities. The purpose of the safety officer's safety inspection is to identify,
eliminate, or control physical hazards (in the work place) and unsafe work practices by the employee.
The following form is provided for reporting results of safety inspections. A copy of the inspection
report will be forwarded to Risk Management and reviewed for appropriate action by the Safety Officer,
Risk Management.
Section 1100.202 Inspections
A. All safety officers shall make monthly inspections of the work activities, buildings, and
premises. The Building Service Director will assume the responsibility of the monthly safety
inspection of the Municipal building, Annex and Law Enforcement Center. Attention will be
directed to -
1. Work practices;
2. Housekeeping and general physical conditions;
3. Waste collection and disposal;
4. Fixed and mobile equipment;
5. Storage of flammable liquids or gases;
6. Use and storage of supplies or equipment;
7. Firefighting equipment.
D. LOSS PREVENTION
Section 1100.301 Loss Prevention Purpose
The purpose of this section is to provide policy and guidance on the prevention of loss of equipment and
Attachment number 2
Page 218 of 269
Item # 11
All Rights Reserved 219 | P a g e
supplies by - theft, negligence misappropriation, willful destruction, or lost equipment.
Section 1100.302 Loss Prevention Policy
Each employee of Augusta, Georgia has a direct responsibility to safeguard equipment and supplies
entrusted to him or her in the performance of their official duties. To this end, every employee will take
reasonable and necessary precautions to prevent the loss, destruction, damage to or misappropriation of
equipment and/or supplies belonging to Augusta, Georgia.
Section 1100.303 Loss Prevention Applicability
This section applies to all departments, agencies, offices or sections subordinate to Augusta, Georgia.
Section 1100.304 Loss Prevention Responsibilities
A. Department Directors
1. Establish departmental policies and procedures for the accountability of property and
supplies. Policies will be in writing and posted for employee notification. The form Policy
Letter (Form RM-PL) may be used for this purpose.
2. Ensure their respective departments maintain an accurate listing of equipment having serial
numbers and/or asset numbers, not including vehicles.
3. Periodically checks to ensure property with asset numbers or serial numbered items is
inventoried (a minimum of once each year - September) and provides a report to
Purchasing.
4. Submits an Incident Report (Form RM-AGIR) upon learning of the loss, damage,
destruction or theft of department property in excess of $1105.00 or property with an asset
number, to Risk Management.
B. Supervisors
1. Will ensure all employees under their direct supervision are aware of departmental policies
on loss prevention.
2. Will ensure employees are trained on the proper use of assigned equipment.
3. Makes on the spot corrections to employees abusing equipment or in violation of their
policy.
4. Responsible for common use equipment assigned to their crew, section, or team.
5. Periodically inspects common use equipment and equipment assigned to subordinates to
ensure proper maintenance and care.
C. Employees
1. Responsible for the proper maintenance and security of equipment assigned to him/her.
2. Takes necessary action to prevent the loss, damage, destruction or theft of property assigned
to him/her.
3. Reports any loss, damage, destruction or theft of property assigned to them, immediately to
their supervisor.
Section 1100.305 Lost, Damaged or Destroyed Property
A. Employees charged with equipment which has been lost, damaged or destroyed will report such
to their supervisor.
1. An "Incident Report" (Form RM-AGIR) will be filled out and submitted to the department
head.
Attachment number 2
Page 219 of 269
Item # 11
All Rights Reserved 220 | P a g e
a. Reports covering equipment that is essential to "total" department operations (i.e. - radio
base station [as opposed to a single radio], office computer, single specialized piece of
equipment, etc.) will be forwarded to Risk Management.
b. Reports covering equipment that is not essential to "total" department needs will be
disposed of by the department head in accordance with departmental policy.
c. Before liability is established it is essential the department head have the incident
investigated by a disinterested party.
d. Any equipment with an asset number which is lost, damaged or destroyed beyond repair
will be reported to the Purchasing Department who maintains a master list.
Section 1100.306 Theft or Vandalism
A. Property which has been stolen will be reported to the Sheriff's Department (or appropriate law
enforcement agency) and an incident report submitted to Risk Management. A copy will be
sent to Purchasing by Risk Management.
B. Property which has been vandalized will be reported to the Sheriff's Department (or appropriate
law enforcement agency) and an incident report submitted to Risk Management.
C. The loss or theft of an Augusta, Georgia owned/purchased firearm will be reported immediately
to the Sheriff's Department and an incident report forwarded to Risk management.
Section 1100.307 Property Accountability
A. Issued Personal Equipment - Equipment which is issued to an employee is the responsibility of
the employee the equipment is issued to. As such the employee will take reasonable and
necessary precautions to safeguard and maintain property issued to them.
B. Equipment should be inspected upon receipt for serviceability and ensure that no damage is
apparent. Inspections should be made at the time of issue by the receiver.
C. Equipment issued for the sole use by the employee may be issued on a Property Receipt Form
(Appendix 10). A copy of this receipt should be maintained on file at the department.
D. Common use property, issued for short duration should be routinely inspected by the receiving
employee at the time of receipt. Any damage should be immediately reported to the supervisor
or person issuing the equipment.
E. TO ESTABLISH COMMON WRITTEN POLICY AMONG DEPARTMENTS - Employees must
exercise due care with small and/or portable equipment assigned for their use, i.e. power
tools, two-way radios, laptop computers, GPS handheld devices, cameras, cell phones,
pagers, etc. When equipment of a portable nature is issued/assigned to an employee and that
equipment is lost, damaged, destroyed or stolen (not recovered) the employee will be
expected to pay the replacement cost of such property.
Section 1100.308 Supplies
A. Supplies are classified into two categories - expendable but accountable (construction materials,
replacement parts, consumable goods, etc.) and expendable -non-accountable (office materials -
pens, paper, etc.).
1. Accountable Supplies must be track able by audit (purchase order to work order, purchase
order to job, etc). Materials in excess of job requirements must also be accountable.
2. Expendable supplies should be regulated to protect against misappropriation.
Attachment number 2
Page 220 of 269
Item # 11
All Rights Reserved 221 | P a g e
3. Consumable goods should be auditable from the time of issue to the supported activity and
bank deposit (if appropriate). Items which have spoiled or must be destroyed (non-sellable)
must be accounted for as an annotation on an inventory sheet or a memorandum of
destruction, giving all pertinent data to include the reason for destruction.
E. VEHICLE OVERSIGHT PROGRAM
Section 1100.401 Vehicle Oversight Program Purpose
A. The Vehicle Oversight Program has numerous purposes -
1. Provides management a tool to better utilize available resources.
2. Provides management a tool to monitor employee productivity.
3. Enhances the risk reduction program.
4. Reinforces current vehicle utilization policy (Fleet Management)
5. Increases safety awareness
6. Enhances Augusta Cares Program
Section 1100.402 Vehicle Oversight Program Concept
Vehicles owned by the Augusta, Georgia Commission will have Global Positioning Systems (GPS)
installed with monitoring capability at the respective department level. Central monitoring will be
available through Risk Management and Fleet Management as well. Cost of the system and
monitoring fees will dictate the number of systems installed.
Section 1100.403 Vehicle Oversight Program Applicability
This program is applicable to departments and agencies subordinate to the Augusta, Georgia
Commission. Vehicles assigned to Constitutional Officers or Elected Officials are not subject to this
program.
Section 1100.404 Vehicle Oversight Program Responsibilities
A. Administrator - Overall responsible for the overall supervision of the monitoring program.
B. Risk Management - Provides for program implementation, information briefings to
respective departments and provides primary centralized monitoring of vehicles.
Coordinates funding for program support, continuity and sustainment.
C. Fleet Management - Assists Risk Management with program implementation and
coordination. Provides secondary centralized monitoring of vehicles. Responsible for
coordinating the installation of systems on vehicles as directed.
D. Departments - Provides departmental monitoring and operational supervision.
E. All employees will be required to sign a form (Employee Acknowledgement Vehicle
Oversight Program form) that acknowledges they understand GPS devices will be used in
vehicles/equipment owned by the Augusta, Georgia Commission and they are aware of
potential consequences when abuse is discovered.
Attachment number 2
Page 221 of 269
Item # 11
All Rights Reserved 222 | P a g e
Section 1100.405 Vehicle Oversight Program Funding
A. Initial Funding - provided by Risk Management and will include the purchase of system
hardware, activation and monthly/annual fees.
B. Sustainment Funding - provided by Risk Management for the monthly fees and included in
the allocation process.
Attachment number 2
Page 222 of 269
Item # 11
All Rights Reserved 223 | P a g e
Form RM-PPE
Personal Protective Equipment - SAFETY/RISK MANAGEMENT MANUAL SECTION 7
Minimum Essential Personal Protective Equipment
H = Head E = Eye F = Face R= Respiratory V = Vest
X = Required Protection
O = Recommended Protection
Job/Activity H E F Hear R Hand V Foot NOTES
General Construction X O X X See C, 5, a
Traffic Control
Operations/Flagging
X X O
Heavy Equip
Operations
O O O O Based on the type of
operation, Depts.
establish requirement
Tractor Mowing -
Unprotected Cab
X O X
Truck Driving-CDL O O Vest is recommended
to have available
should the driver get
out at a construction
site
Pesticide Spraying X X To be in compliance
with the
PDQXIDFWXUHU·V
suggested safety
equipment listed on
the MSDS or product
warning label.
Spray Painting X X See above
Power Tools X X X
Air Tools X X O
Winches X X X X
Sewer Operations X O O X X As directed by
Director, W&S
Push Mower with gas
engine X X X
The basis for determining the need for protective equipment is, according to OSHA standards, that if the
potential for injury exists then protective equipment should be used.
Attachment number 2
Page 223 of 269
Item # 11
All Rights Reserved 224 | P a g e
Form RM-ODC
OPERATOR'S DAILY CHECKLIST
DATE -______________________OPERATOR -______________________________
VEHICLE # -_____________________ASSET # -___________________MILEAGE -______________
ITEM CHECKED O.K. ( ) NEEDS MAINTENANCE
1. Horn
2. Brakes (including Park)
3. Lights -
a. Head Lights
b. Tail Lights
c. Turn Signals
d. Brake Lights
e. Back up Lights
f. 4 way flasher/hazard
4. Tires - (tread/pressure)
5. Seat Belts -
6. Fluid Levels -
a. Coolant
b. Oil
c. Brake
d. Power Steering
e. Transmission
7. Battery
8. Windshield Wipers and fluid
9. Clutch
10. Damage to interior/exterior
Beginning and end of day
11. Note any unusual noise/problem
12. Other -___________________
_____________________________________ _______________ ________________________________________
DATE TIME IN SIGNATURE
Attachment number 2
Page 224 of 269
Item # 11
All Rights Reserved 225 | P a g e
Form RM-DVI-UV
DAILY VEHICLE INSPECTION
UNASSIGNED VEHICLE
Department ___________________________Vehicle# __________ASSET# _____________
TAG # _____________
DATE DRIVER SUPERVISOR REVIEW
1
2
3
4
5
6
7
INSPECTION ITEMS
ITEM SU M T W TH F S
1. ENGINE COMPARTMENT -
a. Belts
b. Oil level
c. Brake fluid
d. Water/coolant
e. Transmission fluid
f. Hoses
g. Battery
h. Power steering
2. TIRES (air/tread)
3. LIGHTS -
a. Head (Hi/Low)
b. Park
c. 4-Way flasher
d. turn signals
e. Brake
4. DRIVER COMPARTMENT -
a. Horn
b. Windshield wipers
c. Mirrors
d. Seat belts
5. EXHAUST LEAKS
Attachment number 2
Page 225 of 269
Item # 11
All Rights Reserved 226 | P a g e
DAILY VEHICLE INSPECTION
Form RM-DVI-AB AIR BRAKES
DEPARTMENT - DRIVER -
DATE - VEHICLE # - ASSET # -
ENGINE COMPARTMENT
BELTS - Alternator
Compressor
Water Pump
Other
HOSES -
FLUIDS - Water
Oil
FLUIDS - Steering
Transmission
Other
Steering Linkage
Slack Adjusters
Leaf Springs
Rim Seals
COMMENTS
TIRES
TREAD - Check all tires for tread; front tires 4/32 inch minimum with matching tread; rear 2/32 inches -
minimum. SIDEWALL - check for visible punctures, separation, bulges or cuts; PRESSURE - follow
manufacture's recommended pressure.
ELECTRICAL & BRAKES
LIGHTS -
HI Beam
Low Beam
Park - Front
Rear
Turn - Front
Rear
Hazard
Clearance
Brake
Left
_____
_____
_____
_____
Right
_____
_____
_____
_____
BRAKES -
1. Low Pressure Signal
2. Spring Brakes -
3. Air Pressure Buildup rate -
4. Air Leakage Rate -
5. Air Compressor cut in/out
Pressure -
(See Reverse of form)
COMMENTS
CAB
Doors/locks ___ Windows ___
Windshield ___ Wipers ___
Mirrors ___ Steering play (less than 2")___
Fire Extinguisher ___ Warning Triangle
___
Gauges ___ Horn ___
COMMENTS
UNDERCARRIAGE
Frame ___ Cross-members ___
Drive Shaft ___ Exhaust ___
Leaf Springs ___ Slack Adjusters ___(1 in.)
Mounting hardware___ Fuel Tank ___
Drain air tanks to eliminate water/condensation
COMMENTS
Signature -__________________________________________________________________________________
Page 1 of 2
Attachment number 2
Page 226 of 269
Item # 11
All Rights Reserved 227 | P a g e
Page 2 of 2 Air Brakes
TEST LOW PRESSURE WARNING SIGNAL - Shut
the engine off when you have enough air
pressure that the low pressure warning
signal is not on. Turn the electrical power on
and step on and off the brake pedal to
reduce air tank pressure. The low air
pressure warning signal must come on
before the pressure drops to less than 60 psi
in the air tank (or tank with the lowest air
pressure, in dual air systems).
If the warning signal doesn't work, you could
lose air pressure and you would not know it.
This could cause sudden emergency braking
in a single circuit air system. In dual systems
the stopping distance will be increased.
Only limited braking can be done before
the spring brakes come on.
CHECK THAT THE SPRING BRAKES COME ON
AUTOMATICALLY -
Chock the wheels, release the parking
brakes when you have enough air pressure
to do it, and shut the engine off. Step on
and off the brake pedal to reduce the air
tank pressure. The "parking brake" knob
should pop out when the air pressure falls to
the manufacturer's specification (usually in a
range between 20 -40 psi). This causes the
spring brakes to come on.
CHECK RATE OF AIR PRESSURE BUILDUP -
With the engine at operating RPM, the
pressure should build from 85 to 100 psi
within 45 seconds in dual air systems. (If the
vehicle has larger than minimum air tanks,
the buildup time can be longer and still be
safe. Check the manufacturer's
specifications.) In single air systems (pre
1975), typical requirements are pressure
buildup from 50 to 90 psi within 3 minutes
with the engine at an idle speed of 600 -
900 RPM.
If air pressure does not build up fast enough,
your pressure may drop too low during
driving, requiring an emergency stop. Don't
drive until you get the problem fixed.
TEST AIR LEAKAGE RATE -
With a fully charged air system
(typically 125 psi), turn off the
engine, release the service brake,
and time the air pressure drop.
The loss rate should be less than 2
psi in one minute for single vehicles,
less than 3 psi in one minute for
combination vehicles. Then apply
90 psi or more with the brake
pedal. After the initial pressure
drop, if the air pressure falls more
than 3 psi in one minute for single
vehicles (more than 4 psi for
combination vehicles) the air loss
rate is too much. Check for air
leaks and fix before driving the
vehicle. Otherwise, you could lose
your brakes while driving.
CHECK AIR COMPRESSOR GOVERNOR
CUT - IN AND CUT - OUT PRESSURES -
Pumping by the air compressor
should start at about 100 psi and
stop at about 125 psi. (Check
manufacturer's specifications.) Run
the engine at a fast idle. The air
governor should cut -out the air
compressor at about the
manufacturer's specified pressure.
The air compressor at about the
manufacturer's specified pressure.
The air pressure shown by your
gauge(s) will stop rising. With the
engine idling, step on and off the
brake to reduce the air tank
pressure. The compressor should
cut-in at about the manufacturer's
specified cut-in pressure. The
pressure should begin to rise.
Attachment number 2
Page 227 of 269
Item # 11
All Rights Reserved 228 | P a g e
FLEET ACCIDENT REPORT
Form RM-FAR Augusta, Georgia
Date of Accident - Day of the Week
-
Time - No. of vehicles involved -
Augusta Private
Case No.
Location/ Address - Intersection Augusta, Georgia Outside Augusta, Georgia
Augusta VEHICLE OTHER VEHICLE
Drivers Last Name - First Drivers Last Name - First
Department Dept # -
Address - Phone
Dept Address - Phone -
City State Zip Code
License # - State - Class - Expires
-
Drivers License # - State Class DOB
-
OWNER INFORMATION OWNER INFORMATION
Augusta Commission Same as Owners Last Name
First
Driver
Room 217, Augusta, Georgia Building Address -
530 Greene Street
Augusta, GA 30911 (706) 821-2301
City State ZIP Phone
VEHICLE INFORMATION VEHICLE INFORMATION
Year
Make -
Model -
Odometer
-
Year
Make - Model -
Odometer
-
License Plate No.
Asset No.
Vehicle
No.
License Plate No -
State -
Year
-
Color -
VIN Number -
Driver Cited - Yes No
Owners Phone No. Driver Cited - Yes No
INSURANCE INFORMATION INSURANCE INFORMATION
Insurance Co. and/or Agency -
Augusta Commission
Insurance Co. and/or Agency -
Policy No -
Risk Management Department (706) 821-2301
Policy No -
Vehicle Removed by - Towing Driven from
scene
Vehicle Removed by - Towing Driven from
scene
Number of Injuries to Employees________ Number of injuries to Private Citizens -_________
Submitted By - Reviewed By -
Job Title - Job Title -
Attachment number 2
Page 228 of 269
Item # 11
All Rights Reserved 229 | P a g e
FLEET ACCIDENT REPORT (Page 2 of 2)
PRIVATE VEHICLE PASSENGERS EMPLOYEE PASSENGERS
Number of Private Passengers - Name Dept
Number Taken by Ambulance - (list names below)
Injured - Yes No Ambulance - Yes
No
Number Injured/No Ambulance -(list names below)
Name Dept
INJURIES TO PRIVATE PASSENGERS
Injured - Yes No Ambulance - Yes
No
CONDITIONS
Weather -
Clear__Cloudy__Rain__Fog___Snow/Ice__
Road Surface - Dry_____, Wet___, Gravel___,
Sand___, Asphalt___, Dirt ___, Mud___,
Grass___.
FACTORS
Check the Boxes that apply - Mechanical Failure Present Driver Error Excessive Speed
Alcohol Involved Drugs Involved Seatbelts NOT USED
ACCIDENT DESCRIPTION -
Attachment number 2
Page 229 of 269
Item # 11
All Rights Reserved 230 | P a g e
Form RM-AGNEO
AUGUSTA, GEORGIA NEW EMPLOYEE ORIENTATION
1. The following subjects were discussed with the employee whose signature appears below. These
subjects are discussed during the New Employee Orientation given by the Human Resource
Department and Risk Management as indicated -
HUMAN RESOURCE
a) Group Hospitalization
b) Group Life Insurance
c) Retirement Plan
d) Tax Deferred Annuity Plan
e) Direct Deposit
f) Photo Identification
RISK MANAGEMENT
a) Substance Abuse Policy
b) Wellness Program
c) Employee Assistance Program
d) Workers Compensation
e) Safety Program
f) Vehicle Oversight Program
DEPARTMENT
2. The following subjects were discussed with the employee whose signature appears below concerning
DEPARTMENT policies -
a) Department policy on employees who loose, damage or destroy property.
b) Supervisory "Chain".
c) Department policies on driving Augusta, Georgia vehicles.
d) Department operations (vacation/sick leave/comp time)
e)
f)
____________________ ______ _______________ ______
Employee Name Date Supervisor Date
Copy of signed form should be sent with employee to give to supervisor. Form used for documentation of
departmental training. Department should send completed form to Human Resources to be filed in
HPSOR\HH·VRIILFLDOILOH
To be filed in Department File
Attachment number 2
Page 230 of 269
Item # 11
All Rights Reserved 231 | P a g e
Form RM-MT
MANDATORY TRAINING
REQUIREMENTS DEPARTMENT FREQUENCY
Substance Abuse (Alcohol &
other Drugs (1 Hour)
Substance Abuse Supervisor
Awareness (1 Hour)
ALL Annual
Aids Prevention ALL Annual - *Note - may be
included with Occupational
Exposure to Blood borne
Pathogens training
Occupational Exposure to Blood
borne Pathogens (HBV)
Sheriff
Marshal
Fire
Coroner
RCCI
Landfill
Const/Maint Water &
Sewerage
New Personnel Orientation
Annual (Refresher Training)
Prevention of Heat Injuries All Annual
Protection against
Tornados/Inclement Weather
All Annual -
Recommended for training in
Augusta, Georgia, April or May.
CONCERN/EAP (Can be
performed in conjunction with
Substance Abuse Awareness
Training)
ALL Annual
FIRE PREVENTION/
EVACUATION
ALL Fire Drills to be conducted once
each Quarter, Training-Annual
Attachment number 2
Page 231 of 269
Item # 11
All Rights Reserved 232 | P a g e
Form RM-JHA
JOB HAZARD ANALYSIS
DEPARTMENT - DATE -
REVIEWED BY - APPROVED BY - -
____________________________________________
TITLE - TITLE -
________________________________________________________
TASK/JOB -
PERSONAL PROTECTIVE EQUIPMENT -
JOB STEPS POTENTIAL HAZARD PREVENTION
Attachment number 2
Page 232 of 269
Item # 11
All Rights Reserved 233 | P a g e
Form RM-AGIRF
INCIDENT REPORT FORM
Augusta, Georgia
1. Employee Name -
2. Department
3. Date/Time
___AM
___PM
TYPE of INCIDENT
DAMAGE INJURY REPORTED TO SHERIFF
Damage to Private Property
7KHIWRI*RY·W3URSHUW\
No Yes
Damage WR*RY·W3URSHUW\ Theft of Private Property Case #
Injury to General Public 9DQGDOL]HG*RY·W3URSHUW\
Injury to Employee Other
INJURY DAMAGE/LOSS
4. Name of Injured -
9. Type Property (Make, Model, Serial Number,
Asset Number)
5. Address -
10. Owner -
6. Phone
7. Employee 11. Address/ Phone -
General Public
8. Nature of Injury -
12. Describe Damage -
DESCRIPTION
13. Describe events resulting in damage or injury (who, what, when, where, how, and why) For vehicle
accidents us the Fleet Accident Report
14. If medical treatment or Ambulance was required state the name of the provider (i.e. - Rural Metro,
University/MCG/Augusta Regional)
ANALYSIS
15. What acts, conditions, or failure to act, contributed most directly to this incident?
CORRECTIVE ACTION
16. Corrective Action applied?
17. Supervisor Signature - DATE -
Attachment number 2
Page 233 of 269
Item # 11
All Rights Reserved 234 | P a g e
PROPERTY RECEIPT FORM
Department - Date -
Issue Turn-in
Issued To -
ITEM
#
ITEM DESCRIPTION QUANTITY
ISSUED BY - RECEIVED BY -
Original is maintained by "Issued By", copy to "Received By"
Attachment number 2
Page 234 of 269
Item # 11
All Rights Reserved 235 | P a g e
Form RM-FI
FACILITIES INSPECTION
DEPARTMENT -__________________________________DATE -_________________________
INSPECTOR -_________________________________________________________________
1. Fire Protection/Prevention -
a. Alarm system available and serviceable
b. Extinguishing equipment serviceable
c. Exits free of obstructions
d. Exit doors are functional.
e. Flammable materials are properly stored
f. Stairs/fire escapes clear of debris
g. Employees aware of evacuation procedures
YES NO
2. HOUSEKEEPING -
a. Isles and floors are clear.
b. Storage and piling of materials is not present.
c. Wash and locker rooms clean and not cluttered.
d. Lighting and ventilation is adequate.
e. Waste is disposed of daily.
f. Yards and parking areas are clear and pose no hazards.
g. Utility room is free of stored materials.
YES NO
3. OFFICE EQUIPMENT -
a. Rolling chairs have 5 prong base.
b. Chairs are adjustable to the user.
c. Desks are free from splinters and defects.
d. Electrical devices are serviceable and cords not frayed.
e. Surge protectors, not house hold extension cords, are in use.
YES NO
4. ADMINISTRATION -
a. Notice of Panel Doctors is posted in prominent location for employees.
b. Employees participate in regular safety meetings.
c. First Aid kit is available and stocked.
d. Weather radio is available and serviceable.
YES NO
5. COMMENTS -__________________________________________________________________________
________________________________________________________________________________________
________________________________________________________________________________________
Attachment number 2
Page 235 of 269
Item # 11
Attachment number 2
Page 236 of 269
Item # 11
All Rights Reserved 237 | P a g e
AUGUSTA, GEORGIA
PERSONNEL ACTION REQUEST
(SAFETY REVIEW COMMITTEE DAMAGE ASSESSMENT)
Employee Name - Dept No.
Social Sec No. Emp No.
Miscellaneous -
PLEASE DEDUCT $ IN PAYMENT(S) OF $______
THIS IS A SAFETY REVIEW COMMITTEE DAMAGE ASSESSMENT
CREDIT ACCOUNT - #611-01-5214 35-19902
DATE OF ACCIDENT -
DATE OF LAST PAYMENT -
x X
DATE EMPLOYEE SIGNITURE
IMPORTANT - PLEASE RETURN this form to RISK MANAGEMENT to ensure the automatic deduction
mentioned in your Safety Review Committee letter is not activated. Thank you for your assistance.
Attachment number 2
Page 237 of 269
Item # 11
All Rights Reserved 238 | P a g e
Form RM-SRC-PM
PENALTIES MATRIX
SAFETY REVIEW COMMITTEE
CLASS
DESCRIPTION
Points
ADMIN ACTION
$
FORFEITURE
FORMULA
1 Unavoidable 0 Caution Letter $0 - $0
2 Avoidable with mitigating
circumstances - (i.e.)
a. Bad Weather
b. Road Conditions
c. Emergency Response
d. Other driver action
e. Actions of ground
guide
2-4 Caution Letter $0.00 to $75.00 10% of damages
but not to exceed
$75.00.
3 Avoidable with driver
error (All drivers
contributing)
3-6 Caution Letter $0 to $750.00 First Offense 10%
Second Offense
20%
Third Offense 30%
4 Avoidable with driver
error - (Drivers action was
major contributing factor
4-7 Letter of
Reprimand
$0 to $750.00
Same as Class 3
5 Negligence with extreme
prejudice -
a. DUI (alcohol/drugs)
b. Excessive speed
c. Leaving scene of an
accident
d. Willful traffic violations
10-15
Suspend driving
privileges for
Augusta vehicles
Recommend
Termination
$0 to $1,000.00
1st - 30% of
damages
2d - 50% of
damages
EMPLOYEE CATEGORIES ADJUSTMENTS
CAT SERVICE FORMULA FOR ADJUSTMENTS
0 5 yrs or less Non Senior-1st offense - damages $250 or less=Caution Letter
1 5 yrs 1 day-10 yrs 25% of the damage assessment, all points remain
2 10 yrs 1 day-15 yrs 50% of the damage assessment, all points remain
3 15 yrs 1 day-20 yrs 75% of the damage assessment, all points remain
4 20 yrs 1 day and
beyond
Caution Letter for damages under $500 or 10% of damages but not to
exceed $50.00, all points remain.
ADJUSTMENTS - Adjustments to penalties will be allowed once each 5 yrs, providing the driver is not involved
in an AT FAULT accident within the time. Adjustments are not automatic.
RECOMMENDED POINT DISCIPLINE -5-8 pts=Written Reprimand;9-14=3 day suspension;15 pts=terminate
Attachment number 2
Page 238 of 269
Item # 11
All Rights Reserved 239 | P a g e
Form RM-PL
POLICY LETTER
(Department Internal Policies ² Establishment of New Policy/Procedure)
1. DEPARTMENT - 2. LETTER NUMBER -
3. SUBJECT - 4. DATE -
5. APPROVED BY - 6. EFFECTIVE DATE -
Attachment number 2
Page 239 of 269
Item # 11
Attachment number 2
Page 240 of 269
Item # 11
Attachment number 2
Page 241 of 269
Item # 11
Attachment number 2
Page 242 of 269
Item # 11
All Rights Reserved 243 | P a g e
Form RM-MVR-RF MVR Review Form
Name
Date of MVR
Dept:
Job Title
License Status:
# Current Points:
Tickets in last 7
years:
# of
Incidences
Weight
/Incident
Total
Score
List all
Date/Violation/Pts
DUI/operating while impaired X 8 =
Chemical test refusal X 8 =
Fleeing police X 8 =
Reckless/careless driving X 6 =
Driving under suspended license X 6 =
Leaving scene of accident X 4 =
Speeding (>15 mph over limit or over 75
mph)
X 3 =
Speeding (<15 mph over limit) X 2 =
Improper/illegal lane change or turn X 2 =
Following too closely X 2 =
Traffic signal offenses X 2 =
Failure to yield X 1 =
Failure to signal X 1 =
Operating a defective vehicle X 1 =
Other X 1 =
Describe:
MVR Score Subtotal:
3 Pt adjustment made if no violations within last 3 years Adjustmen
t:
Do any patterns exist on the MVR? Yes No
(e.g. a ticket each year for a couple of years)
Are there any accidents on the MVR? Yes No
Any injuries? Yes No
Any fatalities? Yes No
Any tickets issued due to accident? Yes No
For each YES box marked above, add one point to the score above (NOTE: a fatality
should also be considered as an injury too and results in two points being added to the
score)
Other issues with Record:
TOTAL SCORE:
Attachment number 2
Page 243 of 269
Item # 11
All Rights Reserved 244 | P a g e
Total Scores are:
10 or more Unacceptable
7 ʹ 9 Questionable
4 ʹ 6 Marginal
0 ʹ 3 Acceptable
Reviewer:
Date:
Notification: Date:
Recommendation:
Reason:
Attachment number 2
Page 244 of 269
Item # 11
All Rights Reserved 245 | P a g e
CHAPTER XII.
INFORMATION TECHNOLOGY
Section 1200.001Computer Usage
A. No one shall use any Augusta, Georgia computer or network facility without proper
authorization. No one shall assist in, encourage, or conceal from authorities any unauthorized
use, or attempt at unauthorized use, of any of the Augusta, Georgia's computers or network
facilities.
1. Computers and networks are just like any other Augusta, Georgia facilities - they are to
be used only by people who have permission. Using a computer without permission is
theft of services and is illegal under state and federal laws. In addition, the following
specific computer crimes are defined by state law (Ga. Code 16-9-90 et seq.):
a. Computer theft: (including theft of computer services, intellectual property such as
copyrighted material, and any other property);
b. Computer trespass: (unauthorized use of computers to delete or alter data or interfere
with others' usage);
c. Computer invasion of privacy: (unauthorized access to financial or personal data or
the like);
d. Computer forgery: (forgery as defined by other laws, but committed on a computer
rather than on paper);
e. Computer password disclosure: (unauthorized disclosure of a password resulting in
damages exceeding $500 - in practice; this includes any disclosure that requires a
system security audit afterward);
f. Misleading transmittal of names or trademarks: (falsely identifying yourself or
falsely claiming to speak for a person or organization by using their name, trademark,
logo, or seal, Ga. Code 16-9-93.1).
i. Maximum penalties for the first four crimes in the list are a $50,000 fine and 15
years of imprisonment, plus civil liability. The maximum penalties for computer
password disclosure are a $5,000 fine and 1 year of imprisonment, plus civil
liability.
B. No one shall knowingly endanger the security of any Augusta, Georgia computer or network
facility, nor willfully interfere with others' authorized computer usage.
1. Many of the other regulations given here deal with specific acts of this kind. These
regulations are not all inclusive and you should not assume that other malicious acts or
deliberate security violations are permissible merely because there is no specific rule
against them.
C. No one shall use the Augusta, Georgia's communication facilities to attempt unauthorized
use, nor to interfere with others' legitimate use, of any computer or network facility
anywhere.
1. State and federal laws forbid malicious disruption of computers. Augusta, Georgia does
not tolerate individuals who invade others' privacy, steal computer services, commit
misrepresentation or fraud, or attempt to disrupt computers or network facilities for any
other purpose, including pranks or jokes.
2. In addition, you should be aware that ability to use a remote computer does not constitute
permission. Some computer services are open to the public, and clearly identify
themselves as such (examples are anonymous FTP sites and Gopher servers). However,
the mere lack of security measures does not mean that a computer is open to anyone who
wishes to use it. The same goes for unauthorized use of communication paths, such as
remote dial out modems and the like.
D. No one shall connect any computer to any of Augusta, Georgia's networks unless it meets
Attachment number 2
Page 245 of 269
Item # 11
All Rights Reserved 246 | P a g e
technical and security standards set by the Information Technology department.
1. The applicable requirements depend on what kind of connection is being made. For
example, connecting to the Augusta, Georgia-wide Ethernet cable requires special
authorization, because one improperly configured machine on a network can cause
widespread disruption. The Augusta, Georgia's agreement with KMC
Telecommunications and the Georgia Department of Administrative Services (DOAS)
restricts the dial-in facilities that Augusta, Georgia units can offer. For specific
information, contact Information Technology.
E. All users shall share computing resources in accordance with policies set for the computers
involved, giving priority to more important work, and cooperating fully with the other users
of the same equipment.
1. If you need an unusual amount of disk space, CPU time, or other resources check with
the administrators in charge of the computer rather than risk disrupting others' work.
When resources are tight, work that is necessary to Augusta, Georgia's mission must take
priority over computing that is done to pursue personal interests or self-training on side
topics. In addition, no matter how important your work may be, you are only entitled to
one person's fair share of the machine unless additional resources are available and
appropriate permission has been granted.
2. The administrators in charge of a particular machine, in consultation with the user
community, set priorities for any particular machine.
3. Obtaining extra computer resources through any form of deception (e.g., secretly opening
multiple accounts, misrepresenting the nature of your work, or the like) is strictly
prohibited.
F. No one without specific authorization shall use any Augusta, Georgia computer or network
facility for non-Augusta, Georgia business.
1. By law, Augusta, Georgia can only provide computer services for its own work, not for
private use. In this respect Augusta, Georgia's computers are different from those owned
by colleges or private corporations. If you need unlimited access to computer networks
for private purposes, you can subscribe to a private service such as MindSpring, America
Online, or CompuServe.
2. It is improper to use the Augusta, Georgia's computers for political campaigns, fund-
raising, commercial enterprises, mass mailings, or other outside activities that have not
been granted the use of Augusta, Georgia's facilities. Furthermore, you should be aware
that the ability to use a computer and/or service does not constitute permission or
authorization. If you have questions, contact your supervisor or someone from the
Information Technology department.
G. No one shall give any password for any Augusta, Georgia computer or network facility to DQ\XQDXWKRUL]HGSHUVRQQRUREWDLQDQ\RWKHUSHUVRQ¶VSDVVZRUGE\DQ\XQDXWKRUL]HGPHDQV
whatsoever. No one except the System or LAN Administrators in charge of a computer is
authorized to issue passwords for that computer.
1. Giving your password to an unauthorized person can be a crime under Georgia law. The
criterion is not whether you trust them, but whether Augusta, Georgia has authorized
them.
2. Passwords protect Augusta, Georgia's network, not just the individuals or individual
machines to which they apply. Augusta, Georgia insists that each account be used only by
the person to whom it belongs, so that if problems are detected or abuse is alleged, the
responsible person can be identified. If a department cannot keep passwords secure, it
cannot connect its machines to the Augusta, Georgia-wide network.
3. In general, you should never share your password with anyone else. Likewise, you must
never use or disclose a password that was given to you improperly. A password is like the
key to a building - you are responsible for what happens to it while it is in your care. If
you give it away, you are endangering the entire machine and possibly the network, not
Attachment number 2
Page 246 of 269
Item # 11
All Rights Reserved 247 | P a g e
just your own files. In fact, computer criminals would like to have your password so they
can make it look as though you, not they, are committing the crimes.
4. Do not store the password for one computer in another computer unless your system
administrator has assured you that no security hazard will result. It is easy for a stranger
to walk up to your personal computer and retrieve passwords that are stored in it.
5. You are responsible for choosing a secure password. Do not use names, nicknames,
telephone numbers, or recognizable words in any language because some people guess
passwords by automatically trying every word in a large dictionary. A good way to make
up a secure password is to use the initials of a phrase, and include some capital as well as
letters. For example, 57ityMwb is a good password, and it's easy to remember because it
stands for "57 is the year Michael was born."
6. Your password is secret. System or LAN administrators will not normally ask you for it.
The computer will never ask you to type it unless you are logging in or changing your
password. Beware of computer programs that ask you to "log in again" or type your
password at any other time; they are likely to be tricks. (There are rare exceptions on
some computers; check with your system Administrator. If anything that you do not
understand ever happens after you type your password, then change your password
immediately).
7. In some instances, Augusta, Georgia authorizes more than one person to share a single
account, but this is seldom the best way to conduct collaborative work. Instead, use file
sharing, groups, and related features of the system you are using. Email can be redirected
automatically to a secretary, who can then forward it to you using a separate mailbox.
H. No one shall misrepresent his or her identity or relationship to Augusta, Georgia when
obtaining or using Augusta, Georgia computer or network privileges.
1. Naturally, you must not claim to be someone else, nor claim to have a different
relationship to the Augusta, Georgia than you actually do, when obtaining a computer
account or access to a lab.
2. You must not falsify your name, address, email address, or affiliation when sending email
or other messages from an Augusta, Georgia computer. Doing so can be illegal (Ga. Code
16-9-93.1 and other laws against misrepresentation), as well as being an unacceptable use
of the Augusta, Georgia's facilities.
3. On some systems, there are ways to post messages without revealing your name and
address. Anonymous communication is permissible when there is a legitimate business
need for additional privacy. It is not a cover for fraudulent or obnoxious behavior, and in
cases of abuse, anonymous messages may be traced to their source. Deceptive
communication, in which you claim to be some other specific person, is never permitted.
4. You can create confusion, and possibly violate trademark law, by using someone else's
trademark as your name on the Net. No matter how loyal a Kodak customer you may be,
do not call yourself "Kodak." That's their name, not yours.
I. No one without specific authorization shall read, alter, or delete any other person's computer
files or electronic mail. This rule applies regardless of whether the operating system of the
computer permits these acts.
1. Do not even try to guess or steal other people's passwords, or read their files, even if the
computer permits this. Doing so would be like rummaging through someone else's desk.
Even if you can pick the lock, and even if there is no lock at all, you have no right to
intrude.
J. No one shall download, copy, install, or use any software or data files in violation of
applicable copyrights or license agreements.
1. This rule forbids making unauthorized copies, for use elsewhere, of software residing on
Augusta, Georgia's computers. It also forbids installing or using pirated software on
Augusta, Georgia computers. The price of a piece of software is not just the cost of the
disk - it's also one user's share of the cost of developing and supporting it. It is wrong to
Attachment number 2
Page 247 of 269
Item # 11
All Rights Reserved 248 | P a g e
use software without paying your fair share.
2. As if that were not enough, unauthorized copying is usually a violation of federal
copyright law.
3. Some software is "site licensed" and can be used on any Augusta, Georgia computer.
(The terms of various site licenses differ.) Some software is genuinely free; the author
allows everyone to use it free of charge. Before copying software, be sure what you are
doing is legal, and consult people who have full information; do not just give yourself the
benefit of the doubt.
4. License checks: If strangers show up at your computer site saying they are there to check
software licenses, you should immediately contact Information Technology and your
administrative superiors. Software licenses do not normally authorize these surprise
inspections, and there is a substantial risk that the "inspectors" are not legitimate.
K. No one shall create, install, or knowingly distribute a computer virus, "Trojan horse," or
other surreptitiously destructive program on any Augusta, Georgia computer or network
facility, regardless of whether any demonstrable harm results.
1. A virus is a hidden computer program that secretly copies itself onto users' disks, often
damaging data. A Trojan horse is a program with a hidden, destructive function, or a
program designed to trick users into revealing confidential information such as
passwords. Even when the harm done by programs of these types is not readily evident,
they confuse beginning computer users, degrade CPU performance, and waste the time of
system managers who must remove them.
L. No one without proper authorization shall modify or reconfigure the software or hardware of
any Augusta, Georgia computer or network facility.
1. Do not modify the hardware, operating system, or application software of an Augusta,
Georgia computer unless someone from Information Technology has given you
permission. The other users with whom you share the machine, and the technicians on
whom you rely for support, are expecting to find it set up exactly the way they left it.
M. Users shall not place confidential information in computers without protecting it
appropriately. The Augusta, Georgia cannot guarantee the privacy of computer files,
electronic mail, or other information stored or transmitted by computer unless special
arrangements are made.
1. Ordinary electronic mail is not private. Do not use it to transmit computer passwords,
credit card numbers, or information that would be damaging if made public. Bear in mind
that some records are required by law, and by Augusta, Georgia policy, to be kept
confidential. It is also necessary to protect confidential information about employees,
such as performance evaluations. This applies not only to networked computers, but also
to computers, tapes, or disks that could be stolen; an increasing number of computer
thieves are after data rather than equipment.
2. Augusta, Georgia will normally respect your privacy but cannot guarantee it absolutely.
A normally private file can end up being read by others many ways. If a disk is damaged,
a system administrator may have to read all the damaged files and try to reconstruct them.
If email is addressed incorrectly, it may go to one or more "postmasters" who will read it
and try to correct the address. For your own protection, system administrators will often
look at unusual activity to make sure your account has not fallen victim to a "cracker."
The Georgia Open Records Act applies to information stored in computers. This act gives
citizens the right to obtain copies of public records, including any record prepared,
received, or maintained by the Augusta, Georgia in the course of its operations. Some
kinds of records are exempt; among these are medical records, confidential hiring
evaluations, trade secrets, and material whose disclosure would violate copyright laws.
Moreover, the Open Records Act is not a license to snoop; requests for information must
be made through proper administrative channels.
N. Users shall take full responsibility for messages that they transmit through Augusta,
Attachment number 2
Page 248 of 269
Item # 11
All Rights Reserved 249 | P a g e
Georgia's computers and network facilities. No one shall use Augusta, Georgia's computers
to transmit fraudulent, defamatory, harassing, obscene, or threatening messages or any
communications prohibited by law.
1. You have exactly the same responsibilities on the computer network as when using other
forms of communication. You must obey laws against fraud, defamation, harassment,
obscenity, solicitation of illegal acts, threatening or inciting violence, and the like. Bear
in mind that uninvited amorous or sexual messages are likely to be construed as
harassment. If you are bothered by uninvited email, ask the sender to stop, and then, if
necessary, consult a system administrator.
2. Use of the computers to circulate chain letters and pyramid schemes is not permitted. If
someone says, "Forward a copy of this to everyone you know on the Internet," do not.
Such messages often contain misunderstood or outdated information, or even outright
hoaxes. Even when the information is legitimate, chain forwarding is a needlessly
expensive way to distribute it. Never participate in schemes to deliberately flood a
computer with excessive amounts of email. "Mail bombing" can incapacitate a whole
computer or even a whole sub-network, not just the intended victim.
3. It is considered good practice to use your real name, rather than a nickname or
pseudonym, in the headers of all outgoing communications. Use of nicknames is often
interpreted as a sign of immaturity or an indication that you are not taking full
responsibility for what you are sending out.
4. Fake electronic mail: All users should be aware that there is no guarantee that electronic
mail actually came from the person or site indicated in it. Deceptive electronic mail is
easy to fake, including the technical information in the header. Doing so is of course
prohibited and is in many cases against the law.
5. Hoaxes, scams, and false warnings: Hoaxes, pranks, and con games are common on the
Internet. Be on the lookout for misguided "warnings" (about computer viruses,
impending legislation, etc.) and false appeals for charity (usually involving dying
children). If you get a message that spurs you to take immediate action, it is very likely to
be a hoax, even if the person who passed it along to you was perfectly sincere. In
addition, genuine appeals that are several years old are still circulating as if they were
current. To reduce the spread of such hoaxes, and to avoid annoying other people, do not
spread such warnings. If you have a concern, contact the Information Technology
Department at 821-2522, or you can forward the message ONLY to the Mail
Administrator (administrator@co.Richmond.ga.us). All official warnings and
notifications will come from the Information Technology Department of Augusta,
Georgia.
6. Augusta, Georgia letterhead: Use prudent caution when sending out any message that
appears to be an official communication from the Augusta, Georgia. If the header
identifies your message as coming from an administrative office or from the office of
someone other than yourself (e.g., "Clerk of Court"), recipients will presume that you are
speaking for that office for person.
7. It is important to distinguish actions taken to punish a person from actions taken to
protect a system. If your account appears to have been misused or broken into, your
system administrator will inactivate it and contact you or wait to hear from you. This is
done to stop the misuse and does not presume that you are the guilty person; you can
expect to have your privileges reinstated right away, with new passwords, as soon as you
identify yourself and indicate willingness to follow the rules. Thus, you can resume using
the computer while investigation of the incident continues.
O. Those who publish World Wide Web pages or similar information resources on Augusta,
Georgia computers shall take full responsibility for what they publish; shall respect the
acceptable-use conditions for the computer on which the material resides; shall obey all
applicable laws; and shall not publish commercial advertisements. References and links to
Attachment number 2
Page 249 of 269
Item # 11
Attachment number 2
Page 250 of 269
Item # 11
Attachment number 2
Page 251 of 269
Item # 11
All Rights Reserved 252 | P a g e
A. Two-ZD\UDGLRV ³5DGLRV´ ZLOOEHXWLOL]HGIRU2IILFLDO%XVLQHVV2QO\
B. No profanity will be transmitted on any radio.
C. Employee shall utilize authorized Talk Groups only.
D. No programming changes will be made unless approved by IT.
E. No hardware or accessories will be added or altered except by IT or authorized personnel.
F. Each employee assigned a radio will be responsible for said unit and accessories to include
replacement in the event of loss or damage due to negligence.
G. Any damage or loss will be noted in writing to IT and Risk Management immediately.
H. Replacement options will be left to the discretion of the Department Director/Manager.
I. No sexually explicit communication will be tolerated in any form while using the radio
system.
J. No radios will be used as a scanner after hours except as authorized by Dept. Head.
K. All transmissions will be kept as brief as possible.
L. All repairs and re-programming will be directed through IT.
M. The radio system and equipment is controlled and directed through IT.
N. Emergency radio functions will be reserved for life threatening functions only.
O. As each radio is issued an electronic ID number which is printed to a computer every time
the talk button is keyed on a radio, the unit will be identified each time the radio is used.
P. The Mutual Aide Channel will be utilized only in emergencies that require immediate
response from public safety departments (i.e. injuries, fire, threat of loss of life, etc.).
Q. Any violation of the above listed policy shall be subject to the Disciplinary Policy Augusta,
Georgia. Any problems or questions concerning the radio system and equipment shall be
directed to the Information Technology Department.
Section 1200.003 Department-Issued Cellular Telephones
A. These employee usage guidelines (plus any additional restrictions imposed by the
department) should be given to and signed for by the employee at the time the cellular
telephone is issued.
B. Cellular telephones should not be used for outgoing calls in a City facility where there is a
telephone line available.
C. If a pager is provided together with a cellular telephone, the pager should be used to screen
calls that can be returned on a line telephone. Cellular telephones are primarily for City
business purposes only. Every effort should be made to contain calls to five (5) minutes or
less. Over limit calls may be evidence of misuse and are subject to appropriate disciplinary
action. Reimbursements of calls will be left to the discretion of the Department
Director/Manager.
D. Employees are expected to exercise good judgment while using the cellular network. Cellular
telephones are subject to monitoring with simplified radio scanner technology, and, therefore,
are not suitable for conversations where privacy or security is a requirement. Cellular
telephones should not be left accessible to other such as in an unlocked car or on a desk.
E. Employees are expected to practice safety while using the cellular network. Cellular
telephones should not be used while the employee is mobile. This includes walking, driving,
biking, etc.
F. Cellular telephone use will be randomly audited.
G. Cellular telephones should not be transferred to individuals without an approved application
for assignment of a cellular telephone.
H. Department-issued cellular phones are subject to the provisions of Section _____ of this
Manual.
Section 1200.004 Violation of Policies
Attachment number 2
Page 252 of 269
Item # 11
All Rights Reserved 253 | P a g e
Any violation of the Information Technology policies may be subject to discipline, up to and
including termination.
Attachment number 2
Page 253 of 269
Item # 11
All Rights Reserved 254 | P a g e
DEFINITIONS
Accretion ± 7KHFKDQJHRIDSRVLWLRQ¶VFODVVLILFDWLRQGXHWRDJUDGXDODQGSHUPDQHQWFKDQJHLQWKH
assigned duties and responsibilities.
Across-the-board Increase - General increase amount given to all eligible employees; may be
either a flat amount or a percentage of base rate, sometimes referred to as general increase.
Administrative Leave - Paid leave not charged to annual leave or sick leave
Anniversary Date - (1) The date used in some merit-pay systems at which a review of the
employee's salary occurs. It may be the anniversary of hiring, last pay increase, promotion or some
other reference point.
Appeal- The right of a regular employee to appear before the Personnel Board to be heard on
matters of discrimination, unfair practices or other grievances of such person in the manner
prescribed in these policies and procedures. EEOC Director should address claims related to
discrimination.
Applicant - An individual who has completed and submitted an application for employment with the
Augusta, Georgia Human Resources Department.
Appointee - An individual selected from a Human Resources referral list in accordance with the
Policies and Procedures.
Appointing Authority - Any officer, commission, board or body having the power of appointment,
employment or removal from positions in any office, department, commission, board or institution;
or any person or group of persons having the power by virtue of the Constitution, Statute, or lawfully
delegated authority to make appointments to positions of employment in Augusta, Georgia
Approved Job Title - This is a job title that is specifically approved by the Commission to be used
by accounting department to track all financial transactions associated with the job itself. An
approved job title cannot be changed by anyone unless approval is granted by the Commission.
Associated Market Reference Values - The combination of Career Family, Career Band, Job
Type/Role, and Contribution Level provides a link to labor market compensation, while the market
criteria contribute to the defined Career Family framework. Comparing salary data with market data
contributes to informed decisions about compensation.
Authorized Position - A position created through the authorized and budgeted addition to an
organizational unit of a position not previously existent.
Base Wage Rate (or base rate) - The hourly rate or monthly salary paid for a job performed. This
does not include shift differentials, benefits, overtime, incentive premiums, or any pay element other
than the base rate.
Benchmarking - 3URFHVVRIPHDVXULQJRQH¶VRZQVHUYLFHVDQGSUDFWLFHVDJDLQVWUHFRJQL]HGOHDGHUV
in order to identify areas of improvement.
Benchmark Job - A standard job used to make pay comparisons, either within the organization or
to comparable jobs outside the organization, to develop or validate a job-worth hierarchy. Pay data
for these jobs are readily available in purchased surveys.
Attachment number 2
Page 254 of 269
Item # 11
All Rights Reserved 255 | P a g e
BFOQ - Bona-Fide Occupational Qualifications - legally defensible minimum qualifications to
perform the job.
Broad Banding - A pay strategy that consolidates a large number of relatively narrow pay grades
into much fewer broad bands with relatively wide salary ranges, typically in the neighborhood of
100 percent or more.
Callback - An off-duty employee called back to work due to emergency or other unforeseen
circumstances.
Career Band - A sub-set of jobs commonly found in the market with a recognized discipline
specialty and grouped within the larger context of a Career Family.
Career Development - An on-going and formalized effort that focuses on developing enriched and
training of capable workers.
Career Family - A broad meaningful grouping of jobs commonly clustered within a career
emphasis content of defined work within a job is key criteria in determining relationship to this
familial structure.
Career Ladder Positions - Positions that are filled competitively at grades below the journeyman
level, and based on job performance and experience, incumbents are allowed to move up to
journeyman level without competition
Career Path - A series of defined levels where the nature of work is similar and the levels represent
the organization's typical requirements for career growth. Parallel ladders and overlapping ladders
are often created to allow transition from one field to another (e.g., from engineering to
management).
Certification - Eligible applicants submitted to a hiring Department by the Human Resources
Department from an employment, re-employment, or promotional referral list.
Class or Class of Positions - A group of positions in the classified service established under these
Policies and Procedures which are sufficiently similar in duties, responsibilities and authority to be
given the same job title, the same minimum qualifications, the same qualifying examination, and the
same salary range.
Class Family - The grouping of classes according to the general functional nature or character of
duties performed.
Class Group - A major subdivision of the classified service embracing related occupational duties.
Class Series - A subdivision of the classified service consisting of two or more classes of positions,
similar as to line of work, but differing in responsibility or difficulty, which constitute steps in a
normal line of promotion.
Classified Service- The classified service consists of all positions included in the classification and
pay plan with the exception of those positions specifically excluded by the Augusta, Georgia
Commission.
Class Specifications (Job Descriptions) ± The description of each class of position that establishes
a class title, characteristics of the class, examples of duties, knowledge, skills, abilities required, and
Attachment number 2
Page 255 of 269
Item # 11
All Rights Reserved 256 | P a g e
minimum qualifications for the class.
Classification - A descriptive designation for a class and all positions of a class.
Classification Plan - The orderly and systematic arrangement of classes into series and groups.
Classified Employee - An employee holding a position covered by the Augusta, Georgia Classified
Service.
Classify - The act of assigning a position to the appropriate class in accordance with its duties,
responsibilities, and authority.
Classification Method of Job Evaluation - Compares jobs on a "whole" job basis. Predefined
class descriptions are established for each job and jobs are placed in whichever classification best
describes them.
Classification System - A framework organizations use to arrange jobs into groups based on
similarities of purpose, required skills, duties performed, accountability, work environment and other
common factors.
Closed Ended Questionnaire - A structured questionnaire used for job analysis that provides the
incumbent with a written set of questions regarding job content that limits the responses to a
predetermined set of answers. Questions are either behaviorally based or task based and require
validation.
Comparable Worth - A pay concept or policy that calls for comparable pay for jobs that require
comparable skills, effort and responsibility and have comparable working conditions, even if the
content is different.
Comp-a-ratio - The ratio of an actual pay rate (numerator) to the midpoint or some other control
point for the respective pay range (denominator). Compa-ratios are used primarily to compare an
individual's rate of pay to the mid-point or control point of the range. A compa-ratio may be
calculated for an individual, a group of people, a department, or an entire organization.
Compensable Factors - Elements of a job for which the organization is willing to pay. These are
used to provide a basis for judging job value to create a job worth hierarchy (job evaluation).
Factors are usually measured in degrees and are weighted, based on their pre-determined value to the
organization. Typical factors include skills, effort, responsibility, scope of authority, and working
conditions.
Competitive Job Vacancy - Positions filled through a competitive process where candidates
compete based on merit. These positions may not be pre-selected.
Compensation - The salary or wage rates for work performed.
Compensation Plan - The combination of the Classification Plan, the Pay Plan and the Salary
Administration procedures.
Compensatory Leave - Time off from work in lieu of monetary payment.
Attachment number 2
Page 256 of 269
Item # 11
All Rights Reserved 257 | P a g e
Compression - Pay differentials too small to be considered equitable. For Example, new employees
versus tenured employee. The term may apply to differences between (1) the pay of supervisors and
subordinates, (2) the pay of experienced and newly hired incumbents of the same job, and (3) pay-
range midpoints in successive job grades.
Core Competencies- Integrated knowledge sets within an organization that distinguishes it from the
competitors and delivers value to customers.
Continuous Service- Continuous service is employment, which is uninterrupted except for
authorized leaves of absence, suspension or separation due to a reduction in work force.
Contribution level - Differentiator related to skills, competencies, accountabilities, impact, and/or
employee contribution within a Career Family, Career Band, and Job Role. Clarifies criteria
required to progress within and across Career Families, Career Bands, and Job Roles.
Control Point - The point within a salary range representing the desired pay for a fully qualified,
satisfactory (average) performer in a job or group of jobs at a given time (usually the midpoint of a
salary range).
Controlled Substances/Drugs/Illegal Substances - For the purposes of this Policy, "Drugs" include
illegal street drugs, legal drugs either taken for non-medical reasons or without a valid prescription,
and alcohol. It DOES NOT include prescription medication prescribed for the employee by a
qualified health care provider and taken in accordance with that physician's instructions. Some of the
drugs which are considered controlled substances under Federal, State or local laws include, but not
limited to - marijuana, heroin, hashish, cocaine, hallucinogens, inhalants and designer drugs, and
depressants and stimulants which are not prescribed for current personal treatment by a licensed
physician.
Cost-of-living adjustment (COLA) - An across-the-board wage and salary increase or
supplemental payment designed to bring pay in line with increases in the cost of living to maintain
real purchasing power.
Days - Calendar days unless otherwise specified.
Decentralization - Transferring responsibility and decision-making authority from a central office
to other people and locations closer to the situation that demands attention.
Demotion - Involuntary - An involuntary change of employment from a position of one class to a
position of another class leading to a reduction in grade and/or pay. It may also be a reduction in
pay within an assigned pay grade.
Demotion - Voluntary Grade Reduction - A voluntary change of employment to a position in a
class having a lower grade and pay than the position previously held. This action may not be
appealed.
Department - An organizational function composed of one or more groups of major operational
units within a function, and which consists of an executive head reporting to a constitutional officer,
Administrator, the Board, commission, or authority, as reflected on an official organizational chart
approved by the appointing authority.
Department Director- Person holding the position, whether appointed or elected, with overall
administrative/managerial responsibility for a department.
Attachment number 2
Page 257 of 269
Item # 11
All Rights Reserved 258 | P a g e
Directed Reassignment - Management directed reassignments to positions at the same or lower
grade level or job series with no reduction in pay (involuntary).
Disciplinary Action - Either letter of counseling, written reprimand, demotion, suspension,
dismissal, or any combination resulting from misconduct or performance deficiencies of an
employee.
Division - A major part or section of a department, office, bureau, etc., that has been divided for
administrative reasons.
Downgrading - The movement of a job to a lower level in a job-evaluation system (i.e., to a lower
job grade and/or pay range within a pay structure).
Exempt - Exempt salaried employment is defined as work meeting the rules of exemption from
overtime provisions of the federal FLSA. Employees with exempt status are compensated for the
results they are expected to accomplish regardless of the number of hours worked. Each of these
employees would qualify under the Administrative, Professional, Computer-Related Professional, or
Executive exemption standards of the FLSA.
Extrinsic Rewards - Work-related rewards that have value measurable in monetary terms, as
opposed to intrinsic rewards, such as satisfaction in a job well done.
Elected Official - The persons filling the offices of Sheriff, District Attorney, Tax Commissioner,
Probate Judge, Judge and Solicitor General of State Court, Judge of Superior Court, Judge of Civil
and Magistrate Court, Coroner, and Clerk of Superior Court are considered to be elected officials.
Persons employed by these officials do not have a property interest in their positions and are
considered to be "Employees At Will" who work for elected officials and have no Grievance rights,
except as may be granted by the elected official's adoption of these policies and procedures.
Emergency Appointment - A temporary appointment by approval of the Administrator, without
competition, to meet unforeseen conditions or other situations requiring immediate staffing without
delays.
Employee - A person employed in a position in Augusta, Georgia, for which he/she is compensated
on full-time, part-time or temporary basis.
Employee Benefits-Participation of regular employees, employees of elected officials, and
probationary employees in any Augusta, Georgia sponsored health, dental, life insurance, retirement
plan, vacation and sick leave accrual, long term disability, funeral pay, and holiday pay. Materials
and plan documents outlining various employee benefits are available for review in the Human
Resources Department.
Employment Date - For the purpose of longevity, the employee¶V EHJLQQLQJ GDWH LQ D UHJXODU
DSSRLQWPHQW,QWKHHYHQWRIDOHDYHRIDEVHQFHZLWKRXWSD\WKHHPSOR\HH¶VHPSOR\PHQWGDWHVKDOO
be adjusted forward by the number of calendar days absent, in excess of sixty (60) days, within any
twelve (12) month period. ,QWKHHYHQWRIOD\RIIWKHHPSOR\HH¶VHPSOR\PHQWGDWHZLOOEHDGMXVWHG
by the amount of time the employee was in layoff status.
Equity - When used in reference to direct pay this concept refers to a criterion of pay based on
similar responsibilities and contribution to the organization. It may focus on the "fairness" of pay
between employees within or outside the organization.
Attachment number 2
Page 258 of 269
Item # 11
All Rights Reserved 259 | P a g e
Examination or Test - Types of examinations - 1. An examination for which all applicants are
required to appear at a specific time and place for the purpose of taking a written, oral, performance
RU DJLOLW\ WHVW $Q H[DPLQDWLRQ LQ ZKLFK WKH DSSOLFDQW¶V TXDOLILFDWLRQV DV FRQWDLQHG LQ WKH
application are evaluated in terms of education and experience.
Examination (or Exam) Plan - The rating plan by which an applicant is evaluated for the necessary
knowledge, abilities, and skills for a given class of position.
Exchange Rate - Economically defined as the intersect of the labor demand and the labor supply
functions in an external market. It constitutes the wage rate that employers are willing to pay and
labor is willing to accept. From a compensation viewpoint, the exchange rate defines the criterion of
external equity.
Factor Comparison Method - A job evaluation method in which a series of rankings are performed
to assess which jobs contain more of each specific compensable factor than other jobs being
evaluated The factor rankings of each job are assigned numerical values, weighted and then added
together to determine the total job score
Firefighters - Employees of the Augusta, Georgia Fire Department who are certified fire
suppression personnel pursuant to O.C.G.A. sec. 25-4-1 et seq.
Green Circle - The rate of pay that is less than the minimum rate for that salary grade. An
employee paid under this circumstance will normally be eligible for increases that will bring that SHUVRQ¶VVDODU\XSWRWKHPLQLPXPRIWKHVDODU\UDQJH
Geographic Differentials - Pay differences established for the same job based on variations in costs
of living or costs of labor among two or more geographical areas.
Grievance - Any dispute concerning the interpretation or application of these personnel policies and
procedures or any decision relative to certain informal disciplinary actions. The EEOC Coordinator
will handle allegations of discrimination.
Hiring Rate - As a matter of wage policy, the beginning rate at which people typically are hired into
a job.
Hourly Rate - The rate of pay per hour for a job being performed. An "hourly" worker may be
assigned to various rated jobs during any pay period and is paid the "rate" applicable to each job
while working on it.
Incentive (pay plans) - Pay plans designed to reward the accomplishment of specific results.
Awards are usually tied to expected results identified at the beginning of the performance cycle. The
plans can be individual, group, companywide, or a combination of any. Incentive plans are
"forward" looking; bonus plans look "backward."
Incumbent - 6DPHDV³(PSOR\HH´
Indirect Pay - All forms of non-direct (i.e., noncash) compensation made to employees in exchange
for their contribution to an organization.
Individual Equity - The perceived fairness of individual pay decisions.
Attachment number 2
Page 259 of 269
Item # 11
All Rights Reserved 260 | P a g e
Internal Equity - The perceived fairness of the pay structure within a unit.
Intrinsic Rewards - Rewards that are associated with the job itself, such as the opportunity to
perform meaningful work, complete cycles of work, see finished products, experience variety, and
receive feedback on work results.
Job - The total collection of tasks, duties, and responsibilities assigned to one or more positions
which require work of the same nature and level.
Job Analysis - The systematic, formal study of the duties and responsibilities that comprise job
content. The process seeks to obtain important and relevant information about the nature and level
of the work performed and the specifications required for an incumbent to perform the job at a
competent level.
Job Description - A summary of the most important features of a job, including the general nature
of the work performed (duties and responsibilities) and level (i.e., skill, effort, responsibility and
working conditions) of the work performed. It typically includes job specifications that include
employee characteristics required for competent performance of the job. A job description should
describe and focus on the job itself and not on any specific individual who might fill the job.
Job Design - The process of organizing work into the tasks required to perform a specific job.
Job Evaluation - A formal process by which management creates a job worth hierarchy, within an
organization. The two basic approaches are the market data approach and the job content approach.
Job Family - A group of jobs having the same nature of work (e.g., engineering) but requiring
different levels of skill, effort, responsibility, or working conditions (e.g., entry-level vs. senior
engineer).
Job Grade - One of the classes, levels or groups into which jobs of the same or similar value are
grouped for compensation purposes. Usually, all jobs in a grade have the same pay range.
However, sometimes different jobs in the same pay grade have different pay ranges, due to market
conditions for some of the jobs.
Job Code - A referencing code that reference Augusta, Georgia¶VUHIHUHQFLQJFODVVVSHFLILFDWLRQWR
which our job class is associated.
Job Slotting - Review and evaluation of a job, its duties and its tasks against other similar/like
positions already in place in an organization in an effort to appropriately position the job in the
proper Career Family, Career Band, Job Role, and Contribution level.
Job Specifications - A section of the job description that defines what worker characteristics (i.e.,
the knowledge, skills and abilities) are required to perform the job for it to be carried out
competently. These characteristics must be bona-fide occupational qualifications (BFOQs).
Job Title - Label used to describe a set of specific activities, responsibilities, duties and tasks
Job Worth Hierarchy - The perceived value of jobs in relationship to each other within an
organization. The job worth hierarchy forms the basis for grouping similar jobs together and
establishing salary ranges.
Attachment number 2
Page 260 of 269
Item # 11
All Rights Reserved 261 | P a g e
Knowledge-based Pay - A system of salary differentiation based on the formal education, related
experience or specialized training a professional employee has that qualifies the individual to deal
with specific subject matter, or work effectively in a specific field. Salary level may not be
dependent on whether the incumbent utilizes the knowledge.
KSA (Knowledge, skills, and abilities) - Common job specifications. Knowledge refers to
acquired information necessary to do the job (e.g., principles of nuclear physics). Skills refer to
acquired measurable behaviors (e.g., autoclave operation). Abilities refer to natural talents or
acquired dexterity (e.g., capacity to lift 200 pounds).
Labor Demand - The highest wage an employer is willing to pay for a given level of employment
or number of employees.
Labor Market - A place where labor is exchanged for wages. These places are identified and
defined by a combination of the following factors - (1) geography (i.e., local, regional, national,
international), (2) industry, (3) education, licensing or certification and (4) function or occupation.
Lateral Transfer - A permanent transfer of an employee in one salary grade to a relatively equal
salary grade. ³5HODWLYHO\ HTXDO´ LV GHILQHGas a change in the new salary range maximum of
plus/minus less than five percent.
Lay-Off - The separation of an employee from the classified service due to lack of work, lack of
funds, abolishment of a position, economic reduction, or other material changes in duties or
organization, as approved by the Augusta, Georgia Commission.
Lead or Lag Policy - Match, follow or exceed the market when adjusting pay structures. For H[DPSOHDQRUJDQL]DWLRQPD\DGRSWD³/HDG3D\3ROLF\´WRDWWUDFWWKHEHVWTXDOLILHGFDndidates
and/or retain top performers.
Leave - An approved type of absence from work as provided for by these Policies and Procedures.
Limited Term Appointment- An appointment to a classified position, the duration of which is
determined by a contract or grant. Benefits are determined by the provision of the agreement.
Lump-sum Increase - Any increase in pay that is made in the form of a single cash payment. The
most common form is the lump-sum merit.
Market - The area from which applicants are to be recruited. The combination of Career Family,
Career Band, Job Type/Role, and Contribution Level provides a link to labor market compensation,
when the market criteria contribute to the defined Career Family framework.
Market Adjustment - The percentage increase to organization, group or individual pay that is
necessary to adjust it to the estimated market level.
Market Reference Point - Compensation philosophy in which an organization chooses to
benchmark to a percentile of the market in order to compensate positions within the organization.
Market Pricing - The technique of creating a job worth hierarchy based on the "going rate" for
benchmark jobs in the labor market(s) relevant to the organization. Non-benchmark jobs are slotted
into the structure based on whole job comparison.
Attachment number 2
Page 261 of 269
Item # 11
All Rights Reserved 262 | P a g e
Maturity Curve - A process of determining employees' salaries as a function of years from the time
of the first degree earned. Maturity curves are most commonly used for pricing jobs in lieu of
relying on job evaluation techniques. The process assumes that years in the profession equate with
more highly valued competencies.
Medical Review Officer- A licensed physician (medical doctor or doctor of osteopathy)
responsible for reviewing laboratory results generated by the Drug Testing program, who has
knowledge of substance abuse disorders and has appropriate medical training to interpret and
evaluate an individual's positive test result together with his or her medical history and any other
relevant biomedical information. A test result will not be deemed positive for the purpose of
disciplinary action until ruled positive by the Medical Review Officer (MRO).
Merit Increase - An increase to an individual's base pay rate based on performance.
Merit Rating - A method for appraising the performance of an employee with respect to his or her
job. It frequently serves as a basis for making pay adjustments, promotion decisions, or work
reassignments.
Midpoint - The salary that represents the middle of a given salary range or pay grade.
Midpoint Progression - The difference in wage rates paid between two adjacent grades, usually
defined as the difference in the midpoints of the two adjacent grades. A midpoint progression is
calculated by taking the difference between two adjacent midpoints as a percentage of the lower of
the midpoints.
Non-exempt - Defined as employment which does meet the provisions of the federal Fair Labor
Standards Act (FLSA) allowing for payment of overtime work by hourly employees.
Non-quantitative Job Evaluation - A method that creates job worth hierarchy based on the
perceived value of the "whole job," but does not utilize quantitative methods. Examples include
classification, ranking, and slotting.
Occupation - Generalized job or family of jobs.
On-call Pay - A nominal amount of compensation provided in return for an employee being
available to report to work at employer's discretion. Because the employee is expected to be easily
reachable and able to report to the work site on short notice, he or she is compensated for having
restricted personal time.
Overtime - Time worked in excess of the regular work schedule for the position in accordance with
the Fair Labor Standards Act. Overtime is defined as all hours in excess of 40 hours in a workweek,
excluding any vacation, sick leave, or funeral leave taken during that week. For certain Law
Enforcement and Fire Protection personnel, "Overtime" and "Work Period" are defined differently
pursuant to the 7(k) exemption under the Fair Labor Standards Act.
Paired Comparison - A ranking technique that compares each job being evaluated individually to
every other job in a pair-wise fashion to determine which job has a higher value. Ranks of jobs are
created which can then be pegged to the market via benchmark jobs.
Part-time Employee - An employee who works on a continuing basis, but does less than a regular
work schedule. Employees in this class are not eligible for any employee benefits.
Attachment number 2
Page 262 of 269
Item # 11
All Rights Reserved 263 | P a g e
Pay Adjustment - A general revision of pay raises. The adjustment may be either across-the-board,
such as cost-of-living adjustments (COLA), or spot adjustments for increases in prevailing wage
rates.
Pay Grade- A salary range with a minimum, midpoint, and maximum pay bracket established to
fairly and competitively compensate an employee for assigned work under the specific job
classification.
Pay Plan - A schedule of pay rates or ranges for each job in the classification plan. May include
rules of administration and the benefit package.
Pay Policy Line - The level at which the organization decides to set its pay against the external
market; usually the midpoint of the salary structure is set as an estimate of the market going rate.
Pay Range - The range of pay rates, from minimum to maximum, established for a pay grade or
class. Typically used to set individual employee pay rates.
Pay Range Overlap - The degree to which the pay ranges assigned to adjacent grades in a structure
overlap. Numerically, the percentage of overlap between two adjacent pay ranges.
Pay Range Width - The width or spread of a pay range, measured by the ratio - Width =
(maximum pay - minimum pay)/minimum pay.
Pay Rate - A specific dollar amount, expressed either as an annual rate, a monthly rate, a semi-
monthly rate, a bi-weekly rate, or an hourly rate, that comprises each pay grade as shown in the pay
plan.
Pay Steps - Specified levels within a pay range. Employees may progress from step to step on the
basis of time-in-grade.
Pay Survey - The gathering of data on wages and salaries paid by other employers for selected key
classes of jobs or benchmark jobs.
Performance Appraisal - Any system of determining how well an individual employee has
performed during a period of time, frequently used as a basis for determining merit increases.
Performance Evaluation -The method of evaluating each employee on an annual basis as to his or
her performance on the job during the evaluation period.
Performance Increase - Salary increase based on job performance.
Permanent Downward Transfer - A permanent transfer of an employee in one salary grade to
another salary grade that has a lower pay range maximum.
Person-based Pay - Compensation programs that base an employee's salary on that individual's
skills or knowledge rather than on the nature of a rigidly defined job. Types include skill-,
knowledge-, and competency-based pay.
Position - The total of duties and responsibilities of a single employee. The total number of
positions in an organization equals the number of employees plus vacancies. A job is typically made
up of several positions that require the same duties at the same level.
Attachment number 2
Page 263 of 269
Item # 11
All Rights Reserved 264 | P a g e
Position Description Questionnaire (PDQ) - A job analysis questionnaire is a form used for
collecting detailed information from both supervisor and incumbent of a position about the duties,
responsibilities, necessary skills, outcomes, and work environment of a particular job.
Premium Pay - Extra pay, beyond the base wage rate, for work performed outside or beyond
regularly scheduled work periods.
Promotion - The (re)assignment of an employee to a job in a higher grade or range in the
organization's job worth hierarchy.
Range Penetration - The level of an individual's pay compared to the total pay range (rather than
compared with midpoint, as in compa-ratio). Range penetration is calculated as - RP = (Pay - Range
Minimum)/(Range Maximum - Range Minimum).
Probationary Employee - An employee serving the initial twelve months of his or her employment,
promotion, transfer or re-employment to any position in the classified service. A probationary
employee is not a regular employee until completion of the twelve (12) month probationary period.
A probationary employee is entitled to accrue vacation and sick leave. Sick leave may be used upon
accrual and vacation can be used after (6) months of employment. Employees of elected officials do
not serve a probationary period, and may be terminated at will.
Promotion - A change of an employee from a position in one class to a position in another class
having a higher minimum and maximum salary and carrying a greater scope of responsibility in the
new position.
Public Hearing - A meeting of Augusta, Georgia Commission or other agency or board, open to the
public, at which any interested party may request to be heard.
Public Record - A record that the public shall have the right to inspect in a reasonable manner
during regular business hours
Qualifications - The requirements of training and experience and other qualifications to be
measured by an appropriate assessment tool.
Basically Qualified (BQ) - meets minimum qualifications for a position.
Highly Qualified (HQ) - meets or exceeds highly qualified criteria for a position.
Not Qualified (NQ) - does not meet minimum qualifications for a position.
Reallocation- A change in the allocation of a position by assigning the funding from one position to
another.
Reassignment- A voluntary transfer at the same or lower grade level.
Recall - Employees who are laid off may be recalled to the affected classes when those positions
become available without further examination.
Reclassification- 7KHFKDQJHRIDSRVLWLRQ¶VFODVVLILFDWLRQGXHWRDJUDGXDODQGSHUPDQHQt change in
the assigned duties and responsibilities.
Recognized Position- An authorized position that is not budgeted.
Attachment number 2
Page 264 of 269
Item # 11
All Rights Reserved 265 | P a g e
Red Circle Rate - An individual pay rate that is above the established range maximum assigned to
the job grade. Hence, the incumbent is usually not eligible for further base pay increases until the
range maximum surpasses the individual pay rate.
Re-employment Priority List (RPL) - A referral list that gives priority consideration for vacancies
for employees affected by layoff as determined by Human Resources.
Referral List - A list of applicants qualified for appointment to a position in the classified service in
any of the ways established by these Policies and Procedures.
Regular Position- Any position that is established in the classified service that is intended or which
is likely to require the services of an incumbent without interruption for an unlimited period, subject
to the provisions of these Policies and Procedures.
Regular Employee - An employee who has completed their probationary period and is scheduled to
work the regular work schedule. (Employees of elected officials do not serve a probationary period
and cannot attain regular employee status as defined by these policies and procedures.) An employee
in this class is eligible for employee benefits. Employees of Elected Officials have no Grievance
rights, except as may be granted by the elected official's adoption of these policies and procedures.
Reliability - Refers to the reproducibility of results with any criterion or method. Also see validity.
Reinstatement- Former employees who voluntarily resign in good standing may be reinstated upon
within twelve (12) months from the date of resignation without competition Department Director
and Human Resources approval, or employees whose employment was interrupted by service in the
Armed Forces shall be reinstated as prescribed by law.
Reprimand- A formal means of communicating, either verbally or in writing, to the employee that a
problem exists and that it must be corrected within a reasonable time.
Resignation- The voluntary termination of an employee at the employee's request. Resignations
must be in writing and submitted to the employee's immediate supervisor or department director.
Safety-Sensitive Position- Safety-sensitive employees are those who perform any of the following
tasks or duties, or have the following qualifications/job requirements ±
1) Certified Law Enforcement Officers;
2) Jailers of Richmond Augusta, Georgia Sheriff's Department;
3) 911 operators/communications officers;
4) Fire Fighters;
5) Crash Fire and Rescue employees (Bush Field);
6) Correctional Officers;
7) Employees who mix chemicals with water;
8) Employees who fuel or maintain aircraft;
9) Employees who maintain airfield facilities, including aircraft ramps, taxi ways or active
runways or median areas around ramps, taxi ways and runways; with the exception of
those positions specifically excluded by the Augusta, Georgia Commission.
10) Employees whose responsibilities include airfield operations or planning activities in
areas described in above;
11) Employees who maintain, repair, or install traffic control markers, signs or devices to
include painting lane markers or directional indicators;
12) Employees of the Recreation Department, classified as Recreational Specialist (I-IV) who
Attachment number 2
Page 265 of 269
Item # 11
All Rights Reserved 266 | P a g e
a) supervises youth, ages 4-12, in day camp activities including, but not limited to;
gymnasium activities which could result in physical harm if not properly
administered (kickball, tumbling, floor exercises, etc.); playground activities
involving use of play equipment requiring constant safety inspection;
b) Transports youth to field trip events in 14 passenger van, requiring out of town
supervisory responsibility, as well as vehicular safety;
c) Supervises outdoor activities on parks in summer heat requiring constant monitoring
of children for heat related illnesses;
d) Supervises youth athletic leagues involving potential physical injuries to children
(football, basketball, etc.);
e) Coaches youth swim teams, requiring contact supervision for water related accidents
and safety;
f) Coordinates food and beverage concessions sold to the public at youth events,
requiring on-going compliance for health standards.
13) Operators of heavy equipment or construction type equipment, without regard to whether
a CDL license is required. Employees who operate Commission vehicles for which a
Commercial Driver.
Target Comp-a-ratio - The organization's planned average (or total) salary for the organization,
group or individual at year-end as a percent of the corresponding average (or total) midpoint.
Temporary Employee Contracted- Persons hired thru outside staffing agency for a specific task or
responsibility. This person is not considered an Augusta, Georgia employee and will not receive any
benefits offered to Augusta, Georgia employees. Their contact normally will not exceed six (6)
months.
Temporary Position- Any position that is established in the classified service that is intended or
which is likely to require the services of an incumbent for a period of time not to exceed six (6)
months.
Termination-The termination of a probationary, temporary, or part-time employee, or the
termination of a regular employee for just cause, as set forth by the progressive discipline policy.
Tiered Pay Plan - A remuneration system that differentiates salary based on time of hire (i.e., new
employees are paid less than current employees for performing the same or similar jobs) as well as
on nature of work performed.
Total Cash Compensation - The sum of all monetary payments made to an individual for services
(i.e., employment) during a given year.
Total Remuneration - The sum of the financial and non-financial value to the employee of all the
elements in the employment package (i.e., salary, incentives, benefits, perquisites, job satisfaction,
organizational affiliation, status, etc.) and any other intrinsic or extrinsic rewards of the employment
exchange that the employee values.
Transfer - The movement of an employee from one position to another.
Unauthorized Leave- A type of absence without leave (AWOL) from work, which is not approved
and may subject the employee to disciplinary action.
Unclassified Employee- An at will employee who is not included in the Classified Service Merit
Attachment number 2
Page 266 of 269
Item # 11
All Rights Reserved 267 | P a g e
System.
Unclassified Position- A position that is not included in the Classified Service.
Upgrading - The advancement of a job to a higher grade or salary range.
Vacancy- A position that is not occupied.
Validity - How well a given criterion actually measures or predicts. Also see reliability.
Wage Differential - Differences in wage rates (for similar jobs) that can occur because of location
of company, hours of work, working conditions, type of product manufactured, or a variety of other
circumstances.
Wage and Salary Survey - Survey of wages paid to employees of other employers in the surveying RUJDQL]DWLRQ¶VUHOHYDQWODERUPDUNHW
Workday- The scheduled number of hours an employee is required to work per day. The normal
workday for Augusta, Georgia is 7.5 hours.
Working Job Title - A customized, descriptive title that provides greater understanding of the LQGLYLGXDOHPSOR\HH¶VUesponsibilities and scope within the assigned Career Family, Career Band,
and Job Type/Role, and Contribution Level. Often Working Title is based on current industry and
professional standards.
Attachment number 2
Page 267 of 269
Item # 11
All Rights Reserved 268 | P a g e
ELECTION OF COVERAGE BY AN ELECTED OFFICIAL
I hereby make the following election in regards to the Augusta, Georgia Personnel Policy and
Procedures Manual (select ONE):
________ I elect to have my position as elected official and its employees to be
governed by and subject to the terms of the Augusta, Georgia Personnel
Policy and Procedures Manual. I understand that this allows myself and my
employees to access Augusta, Georgia resources such as Human Resources
and EEO is determining policy questions and issues.
OR
________ I elect to have my position as elected official and its employees to be
governed by and subject to the terms of the Augusta, Georgia Personnel
Policy and Procedures Manual, EXCEPT the sections relating to discipline,
grievances, and appeals. I understand that this allows myself and my
employees to access Augusta, Georgia resources such as Human Resources
and EEO is determining policy questions and issues.
OR
________ I elect NOT to have my position as elected official and its employees to be
governed by and subject to the terms of the Augusta, Georgia Personnel
Policy and Procedures Manual. I understand that this requires that I provide
my own set of policies and procedures to govern my employees and that
Augusta, Georgia is not in any way responsible for administering my policies
and procedures or for the effects of my policies and procedures.
________________________________
Signature
________________________________
Printed Name
________________________________
Elected Office
________________________________
Date
**This election must be made by all elected officials within thirty (30) days after this Manual is
adopted by the Augusta, Georgia Commission.
Attachment number 2
Page 268 of 269
Item # 11
All Rights Reserved 269 | P a g e
ACKNOWLEDGEMENT OF RECEIPT OF
AUGUSTA, GEORGIA PERSONNEL POLICY & PROCEDURES MANUAL
This Manual is intended for informational purposes only. Nothing in this Manual, Augusta, Georgia
practices, or other communications create an employment contract or term. It does not contain all
the information you will need during the course of your employment. Furthermore, you will receive
information through various notices as well as orally through your supervisor, department head or
elected official.
Augusta, Georgia is committed to reviewing its policies, procedures, and benefits periodically and as
directed by the Augusta, Georgia Commission or Administrator. Accordingly, the policies,
procedures and benefits outlined in this handbook are subject to review and change by Augusta,
Georgia at any time.
You are required to acknowledge receipt of your copy of Augusta, Georgia Personnel Policies and
Procedures Manual and return to Human Resources for inclusion in your personnel file within thirty
(30) days of employment. By signing this acknowledgment you acknowledge that you have
received a copy and will have the opportunity to read the entire Manual and agree to be subject to
the Manual.
_____________________________________________
(Printed Name)
_____________________________________________
(Signature)
_____________________________________________
(Department)
_____________________________________________
(Date)
Attachment number 2
Page 269 of 269
Item # 11
CommissionMeetingAgenda
8/2/20115:00PM
MotiontoApproveanOrdinanceCreatingAugusta,GA CodeSecion2-2-57
Department:9-1-1
Caption:Motionto approveanOrdinancetoAmendtheAugusta,GA
CodecreatingTitleTwoChapterTwoArticleSixSec tion2-2-57
RelatingtoImposinga9-1-1ChargeonPrepaidWire lessService;
ToRepealAllCodeSectionsandOrdinancesinConfl ict
Herewith;ToProvideanEffectiveDateandforOthe rPurposes.
(ApprovedbyCommissionJuly19,2011-secondread ing)
Background:Legislationwaspassedin2008toassessa9-1-1fe eonprepaid
wirelessphones.Amenuofoptionswereprovidedfo rprepaid
wirelesssupplierstousetodeterminethefeesowe dforthe
wirelessservicesold.TheDepartmentofCommunity Affairs
(DCA)wastaskedwithmonitoringcompliancewithth estatutory
requirementsandreceivingthefees.Thelegislativ eintentwasthat
thefeerevenuewastobeusedtofundagrantprog ram
administeredbyDCAtoassistlocalgovernmentsin the
implementationofenhanced9-1-1services.Todate
approximately$28millionhasbeencollected,noto necenthas
beenappropriatedfortheintendedpurposeofagra ntprogramto
localgovernments.Thosefundshavebeendeposited inthestate
generalfundandusedforotherpurposes.Asthema rketforcell
phonesandtelephonelandlinesshifts,theresourc esforthe
operationof9-1-1centershavedeclined.Itisest imatedthat
prepaidwirelessphonesnowrepresentover20%oft heoverall
wirelesscellphonemarket.Theprepaidwirelesspr ovidersand
ACCGagreethatthecurrentsystemisinefficienta nd
burdensome.Thereareprovidersthatdonotcomply withthelaw
andthereisnomonitoringorenforcement.TheNati onal
ConferenceofStateLegislaturesdevelopedmodelle gislationto
offeramorecoordinatedapproachtotheassessment and
collectionofthesefeesonanationalbasis.Th isnewapproachis
tocollectthefeesatthepointofsale,remitthe feestothe
DepartmentofRevenue(DOR)muchlikesalestax,to be
distributedperaformulabasedonpopulationofth ePublicSafety
AnsweringPoint(PSAP).Itisestimatedthatthisn ewapproach
willmorethandoubletheamountofrevenuereceive donan
annualbasis,projectionsindicateapproximately$2 0millionper
yearcomparedtothe$8millioncurrentlyreceived.NotonlywillCover Memo
Item # 12
thisprovideastablesourceofrevenueforthe9-1 -1centersitis
alsomoretransparent.Customerswillbechargedth efeewhen
theypurchaseaprepaidcellphoneorreloadthemi nutesandthe
chargewillbereflectedseparatelyonthereceipt.Everycustomer
whomayaccess9-1-1serviceswillpaythefeeands harein
payingforthesystem.Currently,wehavenowayof knowingif
thissegmentofthecellphonemarketispayingthe irshareforthe
services.SummaryofLegislation·Thisbil lrepealsthe
previousstatueregardingcollectionofthe911fee onprepaid
wirelessphones.Thenewbillsetsoutanewsystem tocollectthe
prepaidfeesatthepointofsale.·A75c entfeewillbe
collectedattheretailpointofsaleforeachphon esoldandeach
purchaseofminutestoreloadaprepaidwirelessph one.·9-
1-1feesarecollectedattheretaillevelandremi ttedtotheDOR
justlikesalestax.·Inorderforthefun dstobetreatedasa
localtax,countiesandmunicipalitiesmustadopta nordinanceor
resolutionimposingthefeeandfilewiththeDOR.·Fees
willbedistributedbacktothecountiesandmunici palitiesthat
adoptedtheordinanceorresolutiononanannualba sis.·The
allocationoffundswillbebasedonthepopulation ofthe
PSAP.Thesefundswillnotbeallocatedbasedonpo intofsale
collections.·Toensureastatewidecollec tionsystemthe
provisionthelanguagewasaddedin(b)(2)thatif acountyof
municipalityfailstoadoptanordinancethefeewo uldberetained
bythestateforthepurposeofagrantprogramto improve9-1-1
systems.Itishighlyunlikelythatanyjurisdictionwillfa iltoadopt
aresolutiontocollectthefee,butifforsomere asonithappens,
thatportionofthefeewouldgothestatejustas itdoesunderthe
currentstatue.·Providesthat3%offees collectedbyretailer
canberetainedbytheretailertooffsetthecosts ofcollectingthe
fee.·Theformulaforshareofthefundsc ollectedonan
annualbasisisthepopulationofthejurisdiction(s)operatingthe
PSAPanddenominatorwhichisthetotalpopulation ofthestate.
·Fundswillbedistributedannuallyonor beforeOctober15
ofyearyear.·PriortodistributiontheD ORmayretainnot
morethan2%ofthetotalamountcollectedforthe costof
administeringtheprogram.·Ifthereisa jurisdictionthat
doesnotadopttheresolutionthefundsallocateda ccordingtothe
formulaforthatjurisdictionwillbedepositedin thegeneralfund
andbeadministeredthroughagrantstocountiespr ogramwiththe
purposeofoperationsofPSAPSandtheimprovement of911.
·TheeffectivedateofthebillinJanuary 1,2012
Analysis:
FinancialImpact:
Alternatives:Deny
Cover Memo
Item # 12
Recommendation:Approve
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 12
Attachment number 1
Page 1 of 4
Item # 12
Attachment number 1
Page 2 of 4
Item # 12
Attachment number 1
Page 3 of 4
Item # 12
Attachment number 1
Page 4 of 4
Item # 12
Attachment number 2
Page 1 of 1
Item # 12
CommissionMeetingAgenda
8/2/20115:00PM
AcceptanceofAssistancetoFirefightersGrant
Department:Fire,ChiefHowardWillis
Caption:Motionto approveacceptanceofEMW-2010-FO-00697,2010
AssistancetoFirefightersGrantProgramsaward.(Approvedby
FinanceCommitteeJuly25,2011)
Background:Duetotheneedtoreplaceandupgradeourprotecti vefirefighting
equipmentandbudgetaryshortfallsinfundingfort hisneed,the
AugustaFireDepartmentsubmittedanapplicationto theFEMA
AssistancetoFirefightersGrantProgramforfunds topurchase
personalprotectionequipmentforthemembersofth eAugusta
FireDepartment.TheAugustaFireDepartmenthasbe enawarded
thefundingthatwasrequestedforthispurchase.
Analysis:Thereisanongoingneedtoreplaceandupgradeper sonal
protectiveclothingforourfirefighters.Thenatur eoffirefighting
andthewearandtearthatthisplacesonthisequi pmentis
constant.Theacceptanceofthisgrantfundingwill allowusto
purchasefirefightingcoats,pants,helmets,glovesan dbootsto
replacesuchwornitemsandallowforadequaterese rvesforfuture
needs.
FinancialImpact:Thetotalgrantrequestforthisequipmentcomesto $344,750.00.
TheFederalshareofthisgrantwillbe$275,800.00 .Thetwenty
percentmatchfortheFireDepartmentwillbe$68,9 50.00.Funding
forthistwentypercentmatchisavailableinthe2 011operating
budget.
Alternatives:Noneatthistime
Recommendation:AccepttheAssistancetoFirefightersGrantProgram sgrant
#EMW-2010-FO-00697awardedtotheAugustaFireDepa rtment.
FundsareAvailable
intheFollowing
Accounts:
27403411053.11420
Cover Memo
Item # 13
REVIEWEDANDAPPROVEDBY :
Finance.
Law.
Administrator.
ClerkofCommission
Cover Memo
Item # 13
Attachment number 1
Page 1 of 5
Item # 13
Attachment number 1
Page 2 of 5
Item # 13
Attachment number 1
Page 3 of 5
Item # 13
Attachment number 1
Page 4 of 5
Item # 13
Attachment number 1
Page 5 of 5
Item # 13
CommissionMeetingAgenda
8/2/20115:00PM
Purchase(2)FellingAirTiltTrailersfromBobcat ofAugusta
Department:EnvironmentalServices/SolidWaste
Caption:Motionto approvethepurchaseof(2)FellingAirTiltTrailers
fromBobcatofAugusta,thelowestresponsivebid,forthe
EnvironmentalServicesDepartment.(ApprovedbyFinance
CommitteeJuly25,2011)
Background:TheEnvironmentalServicesDepartmentdoesnotcurr entlyown
anairtilttrailer.Withtherecentlyaddedresp onsibilityofvacant
lotclean-ups,thetrailerswillbeusedonadaily basisto
accomplishthistaskmoreefficiently.
Analysis:Weareproposingthepurchaseof(2)FellingAirTi ltTrailerswith
thecapacitytosafelycarryourequipmenttothev ariousjobsites.
Thecombinedcostofthe(2)trailersis$78,680.
FinancialImpact:Adequatefundsareavailable.Thedepartmentrecomm ends
transferringfundsfrom542-00-000/13.36110to542-04-
4110/54.22510.
Alternatives:1.Approvethepurchaseof(2)Fellingairtilttra ilersfromBobcat
ofAugusta.2.Donotapprovethepurchase.
Recommendation:Approvethepurchaseof(2)Fellingairtilttraile rsfromBobcatof
Augusta.
FundsareAvailable
intheFollowing
Accounts:
Adequatefundsareavailable.Thedepartmentrecomm ends
transferringfundsfrom542-00-000/13.36110to542-04-
4110/54.22510.
REVIEWEDANDAPPROVEDBY :
Finance.
Procurement.Cover Memo
Item # 14
Law.
Administrator.
ClerkofCommission
Cover Memo
Item # 14
Invitation To Bid
Sealed bids will be received at this office until 11:00 a.m. Friday, May 13, 2011 for furnishing:
Bid Item #11-126 Felling Air Tilt Trailer for Solid Waste Department
Bid Item #11-127 Brillion SSBP 12 Agricultural Seeder for Solid Waste Department
Bids will be received by Augusta, GA Commission hereinafter referred to as the OWNER at the offices of:
Geri A. Sams
Procurement Department
530 Greene Street - Room 605
Augusta, Georgia 30901
706-821-2422
Bid documents may be viewed on the Augusta Richmond County web site under the Procurement Department
ARCbid. Bid documents may be obtained at the office of the Augusta, GA Procurement Department, 530
Greene Street – Room 605, Augusta, GA 30901. Documents may be examined during regular business
hours at the offices of Augusta, GA Procurement Department. All questions must be submitted in writing
by fax to 706 821-2811 or by email to procbidandcontract@augustaga.gov to the office of the
Procurement Department by Monday, May 2, 2011 @ 5:00 P.M. No bid will be accepted by fax, all must
be received by mail or hand delivered.
The local bidder preference program is applicable to this project. To be approved as a local bidder
and receive bid preference on an eligible local project, the certification statement as a local bidder and
all supporting documents must be submitted to the Procurement Department with your bonafide bid
package.
No Bid may be withdrawn for a period of 90 days after time has been called on the date of opening.
An invitation for bids shall be issued by the Procurement Office and shall include specifications prepared in
accordance with Article 4 (Product Specifications), and all contractual terms and conditions, applicable to the
procurement. All specific requirements contained in the invitation to bid including, but not limited to, the
number of copies needed, the timing of the submission, the required financial data, and any other
requirements designated by the Procurement Department are considered material conditions of the bid which
are not waiveable or modifiable by the Procurement Director. Please mark BID number on the outside of the
envelope.
Bidders are cautioned that sequestration of BID documents through any source other than the office of the
Procurement Department is not advisable. Acquisition of BID documents from unauthorized sources placed
the bidder at the risk of receiving incomplete or inaccurate information upon which to base his qualifications.
Funding for this project may include federal funds provided by the U. S. Department of Transportation
(DOT) and/or other federal agencies. All DOT funded projects are subject to the requirements of 49
CFR Part 26. These requirements are mandatory and non-negotiable. Augusta enforces Disadvantage
Business Enterprise (DBE) requirements and/or DBE goals set by Federal and/or State Agencies in
accordance with State and Federal laws. Please be advised that the U. S. District Court for the
Southern District of Georgia has entered on Order enjoining the Race-Based portion of Augusta,
Georgia’s DBE Program. Thus, Augusta, Georgia does not have or operate a DBE, MBE or WBE
Program for projects (or portions of projects) having Augusta, Georgia as the source of funding.
GERI A. SAMS, Procurement Director
Publish:
Augusta Chronicle April 7, 14, 21, 28, 2011
Metro Courier April 13, 2011
cc: Tameka Allen Interim Deputy Administrator
Mark Johnson Solid Waste Department
Lori Videtto Solid Waste Department
Attachment number 1
Page 1 of 1
Item # 14
Ve
n
d
o
r
s
Fl
i
n
t
E
q
u
i
p
m
e
n
t
19
0
0
W
i
l
l
i
a
m
F
e
w
P
k
w
y
Gr
o
v
e
t
o
w
n
,
G
A
3
0
8
1
3
He
r
t
z
E
q
u
i
p
m
e
n
t
20
1
7
R
a
w
l
e
y
R
o
a
d
Au
g
u
s
t
a
,
G
A
3
0
9
0
6
Te
c
-
T
r
a
c
t
o
r
E
q
u
i
p
m
e
n
t
Co
m
p
a
n
y
38
0
9
M
i
k
e
P
a
d
g
e
t
t
H
w
Au
g
u
s
t
a
,
G
A
3
0
9
0
6
Bo
b
c
a
t
o
f
A
u
g
u
s
t
a
28
0
3
W
y
l
d
s
R
o
a
d
Au
g
u
s
t
a
,
G
A
3
0
9
0
9
Ya
n
c
e
y
B
r
o
s
/
C
a
t
e
r
p
i
l
l
a
r
41
6
5
M
i
k
e
P
a
d
g
e
t
t
H
w
t
Au
g
u
s
t
a
,
G
A
3
0
9
0
6
Me
t
r
a
c
/
J
o
h
n
D
e
e
r
e
51
5
C
h
a
m
b
e
r
l
i
n
R
o
a
d
Gr
o
v
e
t
o
w
n
,
G
A
3
0
8
1
3
TM
T
r
a
i
l
e
r
S
a
l
e
s
11
5
M
T
C
a
r
m
e
l
R
o
a
d
Mc
D
o
n
o
u
g
h
,
G
A
30
2
5
3
At
t
a
c
h
m
e
n
t
B
In
c
o
m
p
l
e
t
e
In
c
o
r
r
e
c
t
E
-
V
e
r
i
f
y
#
In
c
o
m
p
l
e
t
e
No
E
-
V
e
r
i
f
y
#
Ye
s
Ad
d
e
n
d
u
m
1
Ye
s
Y
e
s
Ye
s
Br
a
n
d
Fe
l
l
i
n
g
Mo
d
e
l
FT
-
4
0
-
2
T
A
Bi
d
P
r
i
c
e
No
n
-
C
o
m
p
l
i
a
n
t
N
o
n
-
C
o
m
p
l
i
a
n
t
$
3
9
,
3
4
0
.
0
0
De
l
i
v
e
r
y
D
a
t
e
12
W
e
e
k
s
Op
t
i
o
n
a
l
P
r
i
c
e
o
f
Bo
o
s
t
e
r
6.
0
1
-
$
1
7
5
0
.
0
0
6.
0
2
-
$
9
0
0
.
0
0
6.
0
3
-
$
1
5
0
.
0
0
Bi
d
I
t
e
m
#
1
1
-
1
2
6
Fe
l
l
i
n
g
A
i
r
T
i
l
t
T
r
a
i
l
e
r
fo
r
t
h
e
C
i
t
y
o
f
A
u
g
u
s
t
a
-
S
o
l
i
d
W
a
s
t
e
D
e
p
a
r
t
m
e
n
t
Ye
a
r
Bi
d
O
p
e
n
i
n
g
D
a
t
e
:
F
r
i
d
a
y
,
M
a
y
1
3
,
2
0
1
1
@
1
1
:
0
0
a
.
m
.
20
1
1
Pa
g
e
1
o
f
2
Attachment number 2
Page 1 of 2
Item # 14
Ve
n
d
o
r
s
Fe
l
l
i
n
g
T
r
a
i
l
e
r
s
15
2
5
M
a
i
n
S
t
r
e
e
t
S
o
u
t
h
Sa
u
k
C
e
n
t
r
e
,
M
N
5
6
3
7
8
Gl
o
b
e
T
r
a
i
l
e
r
s
3
1
0
1
5
9
T
H
A
v
e
n
u
e
Dr
i
v
e
,
E
a
s
t
Br
a
n
d
e
n
t
o
n
,
F
L
3
4
2
0
3
Tw
a
m
c
o
19
2
0
W
3
5
0
0
S
o
u
t
h
Sa
l
t
L
a
k
e
C
i
t
y
,
U
T
84
1
1
9
AS
C
C
o
n
s
t
r
u
c
t
i
o
n
Eq
u
i
p
m
e
n
t
23
0
3
A
i
r
p
o
r
t
B
l
v
d
Ca
y
c
e
,
S
C
2
9
0
3
3
At
t
a
c
h
m
e
n
t
B
Ad
d
e
n
d
u
m
1
Br
a
n
d
Mo
d
e
l
Bi
d
P
r
i
c
e
De
l
i
v
e
r
y
D
a
t
e
Op
t
i
o
n
a
l
P
r
i
c
e
o
f
Bo
o
s
t
e
r
Bi
d
I
t
e
m
#
1
1
-
1
2
6
Fe
l
l
i
n
g
A
i
r
T
i
l
t
T
r
a
i
l
e
r
fo
r
t
h
e
C
i
t
y
o
f
A
u
g
u
s
t
a
-
S
o
l
i
d
W
a
s
t
e
D
e
p
a
r
t
m
e
n
t
Bi
d
O
p
e
n
i
n
g
D
a
t
e
:
F
r
i
d
a
y
,
M
a
y
1
3
,
2
0
1
1
@
1
1
:
0
0
a
.
m
.
Ye
a
r
Pa
g
e
2
o
f
2
Attachment number 2
Page 2 of 2
Item # 14
Attachment number 3
Page 1 of 2
Item # 14
Attachment number 3
Page 2 of 2
Item # 14
Attachment number 4
Page 1 of 1
Item # 14
CommissionMeetingAgenda
8/2/20115:00PM
2011MillageRate
Department:
Caption:Discussand approvetheproposedmillrates(computedrollback
rates)for2011andproceedtoadvertisetheiradop tiononAugust
4th(proposedrates),scheduledadoptiondate,and advertise5
yearhistoryofdigestintheAugustaChronicleas requiredbystate
law;theschedulingofa10:00A.M.August1910:0 0Special
CalledMeetingtoapproveproposedmillratesasad vertised.
(RequestedbyMayorDekeCopenhaver)
Background:
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 15
CommissionMeetingAgenda
8/2/20115:00PM
AJC-AdditionalParkingArea-ExteriorSiteLighti ngPackage
Department:Recreation,ParksandFacilitiesDepartment-Facil ities
Management
Caption:MotiontoauthorizeGeorgiaPowerCompanytoprocee dwiththe
necessaryprocurement,undergroundrough-in,andti mely
installationofsitelightingfortheexpansionpar kinglot.Thecost
is$124,300.00includingtrenching,undergroundcon duit,wiring,
installationofdecorativepolesandlightsforthe newparkinglot
servingtheJudicialCenterandJohnH.RuffinCour thouse.
(ApprovedbyEngineeringServicesCommitteeJuly25 ,2011)
Background:GeorgiaPowerwasselectedasthelightingsystemp roviderfor
theJudicialCenter.HeeryInternationalhelddiscu ssionswith
GeorgiaPoweroverthepasttwomonthsworkingout detailsfora
parkinglotlightinginstallationthatwillreflect thesamequalityof
theirsitelightingatthenewAugustaJudicialCen ter.-JohnH.
RuffinJr.Courthouse
Analysis:GeorgiaPowerwasfoundtohaveprovidedtheleast expensive
turn-keyoperationforinstallingandmaintainingt heexterior
parkinglotlightingatthenewparkinglot.Thepo lesandlights
willcoordinatewiththeexistingstreetscapelight inginthe
downtownareaandatthenewAugustaJudicialCente r.The
ScopeofWorkincludestrenching,cable,conduit,d irectwire,
poleandlightinstallationandiswithinthebudge tedamountthat
wasestimatedforthisphaseoftheworkattheadd itionalparking
lotarea.
FinancialImpact:Theamountforupfrontcostsfortheparkinglotsi telightingis
$124,300.00.TheGeorgiaPowerpackageincludesag overnment
monthlyratefeeforenergyandlifetimemaintenanc ewarrantyof
thetotalinstallationfor$841.73
Alternatives:1.AuthorizeGeorgiaPowerCompanytoproceedwith the
necessaryprocurement,undergroundrough-in,andti mely
installationofsitelightingfortheexpansionpar kinglot.Thecost
is$124,300.00includingtrenching,undergroundcon duit,wiring,
installationofdecorativepolesandlightsforthe newparkinglotCover Memo
Item # 16
servingtheJudicialCenterandJohnHRuffinCourt house.2.
Awardtothealternateestimatefor$138,400.00and receiveonlya
oneyearwarrantyonthesitelighting.
Recommendation:AuthorizeGeorgiaPowerCompanytoproceedwiththe necessary
procurement,undergroundrough-in,andtimelyinsta llationofsite
lightingfortheexpansionparkinglot.Thecostis $124,300.00
includingtrenching,undergroundconduit,wiring,i nstallationof
decorativepolesandlightsforthenewparkinglot servingthe
JudicialCenterandJohnHRuffinCourthouse.
FundsareAvailable
intheFollowing
Accounts:
FUNDSAREAVAILABLEINACCOUNT:JudicialCenter:GL
–324-05-1120;JL-201150500
REVIEWEDANDAPPROVEDBY :
Finance.
Law.
Administrator.
ClerkofCommission
Cover Memo
Item # 16
Attachment number 1
Page 1 of 1
Item # 16
Attachment number 2
Page 1 of 1
Item # 16
From:Steve Heyward
To:Marion L. Johnson
Cc:John Lukens; Jeff Buser
Subject:Augusta Richmond County Judicial Center Overflow Parking Lot Project
Date:Tuesday, July 05, 2011 10:41:13 AM
Lindsey, after our review of the revised site lighting requirements, including approx. 30 decorative
light poles and approx. 41 decorative light fixtures, our revised site lighting budget is $138,400.00.
Thank you and please let me know if we can be of additional service.
STEVE HEYWARD
Vice President
981 East Freeway Drive | Conyers, Georgia 30094
Phone 770.483.9299 | Fax 770.602.4455 | Toll Free 877.301.7409 | Mobile 404-787-5169
sheyward@pottsco.com | www.pottsco.com
Please consider the environment before printing this email
Attachment number 3
Page 1 of 1
Item # 16
CommissionMeetingAgenda
8/2/20115:00PM
ApproveDesign/BuildContractfortheRenovationst otheCustomerServicesMeteringDivisionBuilding
forAugustaUtilitiesDepartment.
Department:TomWiedmeier,DirectorAugustaUtilitiesDepartmen t
Caption:Motiontoawardsubjectcontracttothe Allen+Batchelor
ConstructionCompany intheamountof$1,173,032.00forthe
renovationstotheCustomerServicesMeteringDivis ionBuilding
forAugustaUtilitiesDepartment.(ApprovedbyEngineering
ServicesCommitteeJuly25,2011)
Background:Allen+BatchelorConstructionCompanyhasbeenapp rovedby
theAugustaCommissiontoprovideDesign/Buildserv icesfor
renovationstoournewmeteringfacilityat1832Wy lds
Road.Thispropertywaspurchasedin2010,andisa djacenttoour
ConstructionandMaintenancefacility.Thisbuildin gwillalso
houseInformationTechnology’sDisasterRecoverySi te.
Analysis:Aconceptualdesignandbudgetaryestimatehasbeen prepared
independentlybyGodefroyandAssociates.Thenegot iatedfeeis
consistentwiththisestimate.
FinancialImpact:Fundingforthisdesign/buildprojectwillbefunde dbyaccount
506043210-5413120.
Alternatives:Noalternativesarerecommended.
Recommendation:AugustaUtilitiesDepartmentrecommendstheCommiss ionaward
subjectdesign/buildcontracttoAllen+Batchelor Construction
Companyintheamountof$1,173,032.00.
FundsareAvailable
intheFollowing
Accounts:
Currentfundingfortheprojectisprovidedundera ccount:
506043210-5413120.
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 17
Finance.
Procurement.
Law.
Administrator.
ClerkofCommission
Cover Memo
Item # 17
Attachment number 1
Page 1 of 14
Item # 17
Attachment number 1
Page 2 of 14
Item # 17
Attachment number 1
Page 3 of 14
Item # 17
Attachment number 1
Page 4 of 14
Item # 17
Attachment number 1
Page 5 of 14
Item # 17
Attachment number 1
Page 6 of 14
Item # 17
Attachment number 1
Page 7 of 14
Item # 17
Attachment number 1
Page 8 of 14
Item # 17
Attachment number 1
Page 9 of 14
Item # 17
Attachment number 1
Page 10 of 14
Item # 17
Attachment number 1
Page 11 of 14
Item # 17
Attachment number 1
Page 12 of 14
Item # 17
Attachment number 1
Page 13 of 14
Item # 17
Attachment number 1
Page 14 of 14
Item # 17
REQUEST FOR QUALIFICATIONS
Request for Qualifications will be received at this office until 11:00 a.m. Friday, February 25, 2011 FOR FURNISHING:
RFQ Item #11-100 Renovations of the Customer Services Metering Division Building for
Utilities Department
RFQs will be received by: The Augusta Commission hereinafter referred to as the OWNER at the offices of:
Geri A. Sams, Director
Augusta Procurement Department
530 Greene Street - Room 605
Augusta, Georgia 30901
RFQ documents may be examined at the office of the Augusta, GA Procurement Department, 530 Greene Street –
Room 605, Augusta, GA 30901. Plans and specifications for the project shall be obtained by all prime,
subcontractors and suppliers exclusively from Imaging Technologies. The fees for the plans and
specifications which are non-refundable is $40.00
Documents may also be examined during regular business hours at the F. W. Dodge Plan Room, 1281 Broad Street,
Augusta, GA 30901. It is the wish of the Owner that all businesses are given the opportunity to submit on this project.
To facilitate this policy the Owner is providing the opportunity to view plans online (www.itrepro.com) at no charge
through Imaging Technologies (706 724-7924) beginning Thursday, January 13, 2011. Bidders are cautioned that
submitting a package without Procurement of a complete set are likely to overlook issues of construction phasing,
delivery of goods or services, or coordination with other work that is material to the successful completion of the
project. Bidders are cautioned that sequestration of documents through any other source is not advisable. Acquisition
of documents from unauthorized sources places the bidder at the risk of receiving incomplete or inaccurate information
upon which to base his qualifications.
A Mandatory Pre-Qualification Meeting will be held on Tuesday, February 8, 2011 @ 10:00 a.m. in the
Procurement Department 530 Greene Street, Room 605. All questions must be submitted in writing to the
office of the Procurement Department by Thursday, February 10, 2011 @ 5:00 p.m. by fax at 706-821-2811 or by
email @ procbidandcontract@augustaga.gov. No RFQ will be accepted by fax, all must be received by mail or hand
delivered.
The local bidder preference program is applicable to this project. To be approved as a local bidder and receive
bid preference on an eligible local project, the certification statement as a local bidder and all supporting
documents must be submitted to the Procurement Department with your bonafide bid package.
No RFQ may be withdrawn for a period of 90 days after time has been called on the date of opening.
An invitation for bids shall be issued by the Procurement Office and shall include specifications prepared in accordance
with Article 4 (Product Specifications), and all contractual terms and conditions, applicable to the procurement. All
specific requirements contained in the invitation to bid including, but not limited to, the number of copies needed, the
timing of the submission, the required financial data, and any other requirements designated by the Procurement
Department are considered material conditions of the bid which are not waiveable or modifiable by the Procurement
Director. Please mark RFQ number on the outside of the envelope.
Bidders are cautioned that sequestration of RFQ documents through any source other than the office of the
Procurement Department is not advisable. Acquisition of RFQ documents from unauthorized sources places the bidder
at the risk of receiving incomplete or inaccurate information upon which to base his qualifications.
Disadvantage Business Enterprise (DBE) Augusta-Richmond County, Georgia does not operate a DBE, MBE or
WBE Program for Augusta funded projects, as a Federal Court has entered an Order enjoining the Race-Based
portion of Augusta’s DBE Program. Instead Augusta operates a Local Small Business Opportunity Program.
However, for various projects utilizing the expenditure of State or Federal funds, Augusta enforces DBE
requirements and/or DBE goals set by the Federal and/or State Agencies in accordance with State and Federal
laws.
GERI A. SAMS, Procurement Director
Publish:
Augusta Chronicle January 13, 20, 27, February 3, 2011
Metro Courier January 19, 2011
cc: Tameka Allen Interim Deputy Administrator
Tom Wiedmeier Utilities Department
Jerry Delaughter Utilities Department
Joe Holland Utilities Department
Attachment number 2
Page 1 of 1
Item # 17
VENDORS Attachment B Bidders Form Addendum Original 7 Copies
ALLEN BATCHELER
1063 FRANKE IND
AUGUSTA GA 30909
YES YES YES YES YES
BLANCHARD & CALHOUN
2743 PERIMETER PKWY
AUGUSTA GA 30909
YES YES YES YES YES
GASKIN CONSTRUCTION CO INC
1527 CRESCENT DRIVE
AUGUSTA GA 30909
YES YES YES YES YES
S.D. CLIFTON CONSTRUCTION INC
4324 WHEELER ROAD
MARTINEZ GA 30907
YES YES YES YES YES
BR WALDEN CONSTRUCTION CO
2320 WALDEN DRIVE
AUGUSTA GA 30909
CONTRACT MANAGEMENT
1827 KILLINGSWORTH ROAD
AUGUSTA GA 30904
GREENE AND BURDETTE
1810 E WYLDS ROAD
AUGUSTA GA 30909
JUTCO INC
1875 POLO ROAD
AUGUSTA GA 30904
LARRY MCCORD DESIGN-BUILD
2016 HIGHLAND AVENUE
AUGUSTA GA 30904
STEWART CORBITT GENERAL CONT
146 RAILROAD STREET
THOMSON GA 30824
TURNER MECH INC
1347 ATOMIC ROAD
BEECH ISLAND SC 29242
DABBS-WILLIAMS GC
319 S WALNUT STREET
STATESBORO GA 30459
JLA
1296 BROAD STREET
AUGUSTA GA 30901
RCN CONTRACTING
1115 FRANKIE PLACE COURT
AUGUSTA GA 30909
STUDIO 3 DESIGN GROUP
1617 WALTON WAY
AUGUSTA GA 30904
RFQ Item #11-100
Renovations of the Customer Services Metering Division Building
for the City of Augusta - Utilities Department
RFQ Due: Friday, February 25, 2011 @ 11:00 a.m.
Page 1 of 1
Attachment number 3
Page 1 of 1
Item # 17
Evaluation Criteria
PTS
ALLEN BATCHELER
1063 FRANKE IND
AUGUSTA GA 30909
BLANCHARD & CALHOUN
2743 PERIMETER PKWY
AUGUSTA GA 30909
GASKIN CONSTRUCTION
CO INC
1527 CRESCENT DRIVE
AUGUSTA GA 30909
S.D. CLIFTON
CONSTRUCTION INC
4324 WHEELER ROAD
MARTINEZ GA 30907
1. Make-up of each design build
consortium
10 9.7 8.7 6.3 7.3
2. Resources of each consortium
10 9.0 7.3 6.3 7.3
3. Experience in design and
construction
25 21.0 19.0 16.0 17.0
4. Technical, process and operational
expertise
20 17.0 16.0 13.7 15.7
5. Financial strength
Pass/
Fail P P P P
6. References
10 9.0 9.0 9.0 9.0
7. Project Approach
10 8.0 6.7 6.3 7.7
8. Performance and Operation
10 8.7 7.7 7.3 7.7
9. Proximity to Augusta
Within Augusta Richmond County - 5 pts
Within the CSRA - 4 pts
Within Georgia - 3 pts
Within SE United States - 2 pt
(includes AL, TN, NC, FL)
All Others - 1pt
5 5.0 5.0 5.0 4.0
Total 100 87.3 79.3 70.0 75.7
Cumulative Evaluation Sheet - RFQ Item #11-100
Renovations of the Customer Services Metering Division Building
for the City of Augusta - Utilities Department
Attachment number 4
Page 1 of 1
Item # 17
Attachment number 5
Page 1 of 1
Item # 17
Attachment number 6
Page 1 of 2
Item # 17
Attachment number 6
Page 2 of 2
Item # 17
Attachment number 7
Page 1 of 4
Item # 17
Attachment number 7
Page 2 of 4
Item # 17
Attachment number 7
Page 3 of 4
Item # 17
Attachment number 7
Page 4 of 4
Item # 17
Attachment number 8
Page 1 of 2
Item # 17
Attachment number 8
Page 2 of 2
Item # 17
CommissionMeetingAgenda
8/2/20115:00PM
CBWDC-FoodTraysandFoodCarts
Department:Recreation,Parks,andFacilitiesDepartment-Faci lities
Management
Caption:Motionto approvethecontractwithCooksDirect,Inc.inthe
amountof$25,849.44forthepurchaseofFoodTraysandFood
Carts(BidItem#11-132)fortheCharlesB.Webster Detention
CenterExpansion.Thisisthelowbid.(Approvedby
EngineeringServicesCommitteeJuly25,2011)
Background:ThiscontactwillprovideadditionalFoodTraysand FoodCarts
fortheWebsterDetentionCenterExpansionforthe Sheriff’s
Officestaffandoperationofthefacility.Thecon structionofthe
renovationsandadditionstotheWebsterDetention Centerwas
approvedbytheCommissiononNovember5,2008.
Analysis:ThisContractwillprovidetherequiredadditional FoodTraysand
FoodCartsfortheadditionalinmatesthatwillbe housedinthe
Male,FemaleandMedical/MentalHealthbuildingadd itions.This
isthelowbid.
FinancialImpact:ThisContractamountwillbefundedbytheproject’sFF&E
budget.Thebudgetisadequatetocoverthecostof thiscontractof
$25,849.44
Alternatives:1.ApprovetheContractwithCooksDirect,Inc.in theamountof
$25,849.44forthepurchaseofFoodTraysandFood Carts(Bid
Item#11-132)fortheCharlesB.WebsterDetention Center
Expansion.Thisisthelowbid.2.Notapprovethe Contact;
howeverthejailfacilityoperationswouldbesever ely
compromised.
Recommendation:ApprovetheContractwithCooksDirect,Inc.inthe amountof$
25,849.44forthepurchaseofFoodTraysandFoodC arts(Bid
Item#11-132)fortheCharlesB.WebsterDetention Center
Expansion.Thisisthelowbid.
Cover Memo
Item # 18
FundsareAvailable
intheFollowing
Accounts:
FUNDSAREAVAILABLEINACCOUNT:JailExpansion:GL
–325-05-1130/206351101
REVIEWEDANDAPPROVEDBY :
Finance.
Law.
Administrator.
Recreation&Parks
Procurement.
Cover Memo
Item # 18
Item # 18
Item # 18
Attachment number 2
Page 1 of 1
Item # 18
AUGUSTA GEORGIA CAPITAL IMPROVEMETS
HEERY ITERATIOAL, IC., PROGRAM MAAGER
501 Greene Street Suite 307 Augusta, GA 30901
706-821-2886
June 16, 2011
Ms. Geri Sams
Director of Procurement
Augusta Georgia
530 Greene Street, Room 605
Augusta, GA 30901
RE: Bid Item 11-132 – Food Trays and Food Carts for the Renovations & Additions to the
Webster Detention Center
Dear Ms. Sams:
We have concluded our review of the bids submitted for the above subject bid.
The lowest base bid is from Cooks (see attached spreadsheet)
The low base bid submitted by Cooks will be accepted.
It is our recommendation that the Contract award be made to Cooks, 27725 Dieh Rd, Warrenville,
Il 60555 in the following quantities:
Food Trays = 456
Food Carts = 10
If there are any questions, please don’t hesitate to contact me.
Cordially,
Richard Ingram
Project Manager
C: Sheila Paulk
Darrell White
Chester Huffman
file
Attachment number 3
Page 1 of 1
Item # 18
Invitation To Bid
Sealed bids will be received at this office until 11:00 a.m. Friday, June 10, 2011 for furnishing:
Bid Item #11-132 Food Trays and Food Carts for Webster Detention Center for the Sheriff’s
Office
Bids will be received by Augusta, GA Commission hereinafter referred to as the OWNER at the offices of:
Geri A. Sams
Procurement Department
530 Greene Street - Room 605
Augusta, Georgia 30901
706-821-2422
Bid documents may be viewed on the Augusta Richmond County web site under the Procurement Department
ARCbid. Bid documents may be obtained at the office of the Augusta, GA Procurement Department, 530
Greene Street – Room 605, Augusta, GA 30901. Documents may be examined during regular business
hours at the offices of Augusta, GA Procurement Department. All questions must be submitted in writing
by fax to 706 821-2811 or by email to procbidandcontract@augustaga.gov to the office of the
Procurement Department by Tuesday, May 31, 2011 @ 5:00 P.M. No bid will be accepted by fax, all
must be received by mail or hand delivered.
The local bidder preference program is applicable to this project. To be approved as a local bidder
and receive bid preference on an eligible local project, the certification statement as a local bidder and
all supporting documents must be submitted to the Procurement Department with your bonafide bid
package.
No Bid may be withdrawn for a period of 90 days after time has been called on the date of opening.
An invitation for bids shall be issued by the Procurement Office and shall include specifications prepared in
accordance with Article 4 (Product Specifications), and all contractual terms and conditions, applicable to the
procurement. All specific requirements contained in the invitation to bid including, but not limited to, the
number of copies needed, the timing of the submission, the required financial data, and any other
requirements designated by the Procurement Department are considered material conditions of the bid which
are not waiveable or modifiable by the Procurement Director. Please mark BID number on the outside of the
envelope.
Bidders are cautioned that sequestration of BID documents through any source other than the office of the
Procurement Department is not advisable. Acquisition of BID documents from unauthorized sources placed
the bidder at the risk of receiving incomplete or inaccurate information upon which to base his qualifications.
Funding for this project may include federal funds provided by the U. S. Department of Transportation
(DOT) and/or other federal agencies. All DOT funded projects are subject to the requirements of 49
CFR Part 26. These requirements are mandatory and non-negotiable. Augusta enforces Disadvantage
Business Enterprise (DBE) requirements and/or DBE goals set by Federal and/or State Agencies in
accordance with State and Federal laws. Please be advised that the U. S. District Court for the
Southern District of Georgia has entered on Order enjoining the Race-Based portion of Augusta,
Georgia’s DBE Program. Thus, Augusta, Georgia does not have or operate a DBE, MBE or WBE
Program for projects (or portions of projects) having Augusta, Georgia as the source of funding.
GERI A. SAMS, Procurement Director
Publish:
Augusta Chronicle May 5, 12, 19, 26, 2011
Metro Courier May 11, 2011
cc: Tameka Allen Interim Deputy Administrator
Forrest White Heery International
Richard Ingram Heery International
Attachment number 4
Page 1 of 1
Item # 18
Ve
n
d
o
r
s
:
No
r
v
e
l
l
F
i
x
t
u
r
e
&
Eq
u
i
p
m
e
n
t
P.
O
.
B
o
x
1
4
8
3
8
Au
g
u
s
t
a
,
G
A
3
0
9
1
9
De
s
i
g
n
S
p
e
c
i
a
l
t
i
e
s
18
9
0
D
i
x
w
e
l
l
A
v
e
Su
i
t
e
2
0
0
Ha
m
d
e
n
,
C
T
0
6
5
1
4
Pl
a
s
t
o
C
o
n
83
6
A
n
d
r
e
w
s
R
d
Su
i
t
e
4
Co
l
u
m
b
i
a
,
S
C
2
9
2
1
2
Ce
n
t
r
a
l
P
o
l
y
C
o
r
p
.
18
D
o
n
a
l
d
s
o
n
P
l
Li
n
d
e
n
,
N
J
0
7
0
3
6
Ca
l
i
c
o
I
n
d
u
s
t
r
i
e
s
90
4
5
J
u
n
c
t
i
o
n
D
r
An
n
a
p
o
l
i
s
J
u
n
c
t
i
o
n
,
MD
2
0
7
0
1
Co
o
k
s
27
7
2
5
D
i
e
h
R
o
a
d
Wa
r
r
e
n
v
i
l
l
e
,
I
L
6
0
5
5
5
At
t
a
c
h
m
e
n
t
B
In
c
o
m
p
l
e
t
e
I
n
c
o
m
p
l
e
t
e
I
n
c
o
m
p
l
e
t
e
Y
e
s
Y
e
s
Fo
o
d
T
r
a
y
s
(E
a
c
h
)
No
n
-
Co
m
p
l
i
a
n
t
No
n
-
Co
m
p
l
i
a
n
t
No
n
-
Co
m
p
l
i
a
n
t
No
B
i
d
Re
s
p
o
n
s
e
$1
0
.
4
0
$
8
.
9
9
Fo
o
d
C
a
r
t
s
(E
a
c
h
)
No
n
-
Co
m
p
l
i
a
n
t
No
n
-
Co
m
p
l
i
a
n
t
No
n
-
Co
m
p
l
i
a
n
t
No
B
i
d
Re
s
p
o
n
s
e
$2
,
1
3
9
.
8
4
$
2
,
1
7
5
.
0
0
De
l
i
v
e
r
y
D
a
t
e
30
D
a
y
s
A
R
O
3-
4
W
e
e
k
s
AR
O
Bi
d
I
t
e
m
#
1
1
-
1
3
2
Fo
o
d
T
r
a
y
s
a
n
d
F
o
o
d
C
a
r
t
s
Fo
r
t
h
e
C
i
t
y
o
f
A
u
g
u
s
t
a
-
S
h
e
r
i
f
f
'
s
O
f
f
i
c
e
Bi
d
O
p
e
n
i
n
g
D
a
t
e
:
F
r
i
d
a
y
,
J
u
n
e
1
0
,
2
0
1
1
a
t
1
1
:
0
0
a
.
m
.
Pa
g
e
1
o
f
2
Attachment number 5
Page 1 of 2
Item # 18
Ve
n
d
o
r
s
:
Gr
e
a
t
L
a
k
e
s
H
o
t
e
l
Su
p
p
l
y
19
6
1
G
r
a
n
d
R
i
v
e
r
Av
e
De
t
r
i
o
t
,
M
I
4
8
2
2
6
At
t
a
c
h
m
e
n
t
B
In
c
o
m
p
l
e
t
e
Fo
o
d
T
r
a
y
s
(E
a
c
h
)
No
n
-
Co
m
p
l
i
a
n
t
Fo
o
d
C
a
r
t
s
(E
a
c
h
)
No
n
-
Co
m
p
l
i
a
n
t
De
l
i
v
e
r
y
D
a
t
e
Bi
d
I
t
e
m
#
1
1
-
1
3
2
Fo
o
d
T
r
a
y
s
a
n
d
F
o
o
d
C
a
r
t
s
Fo
r
t
h
e
C
i
t
y
o
f
A
u
g
u
s
t
a
-
S
h
e
r
i
f
f
'
s
O
f
f
i
c
e
Bi
d
O
p
e
n
i
n
g
D
a
t
e
:
F
r
i
d
a
y
,
J
u
n
e
1
0
,
2
0
1
1
a
t
1
1
:
0
0
a
.
m
.
Pa
g
e
2
o
f
2
Attachment number 5
Page 2 of 2
Item # 18
Attachment number 6
Page 1 of 3
Item # 18
Attachment number 6
Page 2 of 3
Item # 18
Attachment number 6
Page 3 of 3
Item # 18
Attachment number 7
Page 1 of 2
Item # 18
Attachment number 7
Page 2 of 2
Item # 18
CommissionMeetingAgenda
8/2/20115:00PM
DowntownDevelopmentAuthority
Department:ClerkofCommission
Caption:Motionto approvearequestfromtheDowntownDevelopment
AuthorityfortheCitytomatchaDOTEnhancementG rantto
completetheJamesBrownBlvd.StreetscapePhase2 withthe
Administratortorecommendif HUDorSPLOST funding
shouldbeusedfortheproject.(ApprovedbyEngineering
ServicesCommitteeJuly25,2011)
Background:
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 19
Attachment number 1
Page 1 of 1
Item # 19
Attachment number 2
Page 1 of 2
Item # 19
Attachment number 2
Page 2 of 2
Item # 19
CommissionMeetingAgenda
8/2/20115:00PM
PlacementofaplaqueattheSigner'sMonument
Department:PlanningCommission
Caption:Motionto approvearequestbyDescendantsoftheSignersofthe
DeclarationofIndependenceInc.toplacea6"x 9"plaqueatthe
Signer’sMonumentonGreeneStreet.(Approvedby
EngineeringServicesCommitteeJuly25,2011)
Background:TheDescendantsoftheSignersoftheDeclarationo f
IndependenceInc.arerequestingtoplaceasmall(6x9inch)
bronzeplaqueattheSigner'sMonumentonGreeneSt reet.This
nonprofitsocietyhasbeeninexistincefor104yea rsandhas
placedsimilarplaquesaroundthecountry.Theywil lhavethe
plaquemadeandmailedtousandwillassumeallas sociatedcosts
andwillworkwiththeCitytohavetheplaquemoun tedand
placedastheCityseesfit.
Analysis:IthasbeenrecommnededbyHistoricAugustathatth eplaquebe
mountedonapieceofgraniteorsimilarstoneand placeddirectly
onthegroundbesidetheMonument.AGeorgiaHistor icalmarker
isplacedonthewestsidesoitissuggestedthatt hismarkerbe
placedontheeastsideoftheSigner'sMonument.Th isis
agreeabletothepetitioner.
FinancialImpact:NocosttotheCity
Alternatives:Approvethemarker'splacementordeny
Recommendation:Approve
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 20
ClerkofCommission
Cover Memo
Item # 20
CommissionMeetingAgenda
8/2/20115:00PM
RockyCreekDrainageBasin&FloodHazardMitigatio nRFQ:10-199-ContractAward
Department:AbieL.Ladson,PE,CPESC,Director
Caption:Motionto approve andauthorizeAugustaEngineering
Department(AED)toaccepttheproposalfromEMCEn gineering
toprovidedesignandregulatorypermittingprofess ionalservices
forRockyCreekBasin&FloodHazardMitigationpro jectinthe
amountof$350,000,subjecttoreceiptofsignedpr ofessional
servicescontract.(ApprovedbyEngineeringServices
CommitteeJuly25,2011)
Background:ProjectislocatedinRockyCreekDrainageBasinan dprimary
channelflowsthrough.Areaexperiencesfloodingan dproposed
projectwillprovideadditionalfloodwaterstorage volumeto
mitigatefloodhazard.Theproposedfacilitywills erveasaflood
managementfacilityandrecreationalwater-bodywit hanadded
functionofrecreationalareaforthesurroundingn eighborhoods.
Projectgoalistominimizefloodhazard,promoter edevelopment
ofsurroundingproperties,improvedneighborhoodre creational
activities.Thescopeofworkincludesconceptde velopment,
environmentalanalysis,surveysandmapping,hydrol ogicaland
hydraulicanalysis,engineeringdesign(includingd amdesign&
permitting),environmentalandotheragenciespermi tting
(includingcoordinationwithUSACE,FEMAandGADNR),
preliminaryconstructionplans,finalRight-of-Way plansandfinal
constructionplans.
Analysis:Thefollowingfirmswereevaluatedbasedonqualifi cations,
projectapproach,experience,andinterviewsinFeb ruary2011.
ThefollowingfirmssubmittedRFQsandwereevaluat ed:1.ZEL
Engineer.2.WRTooleEngineering3.WKDickson4.Thomas&
HuttonEngineering5.EMCEngineering6.CranstonE ngineering
EMCEngineeringwasselectedbasedontheevaluatio n
proceduresusedforthisproject.
FinancialImpact:FundsareavailablefromCapitalProjectBudgetSPL OSTPhase
IV.324-04-1110/209824002
Alternatives:1)ApproveandauthorizeAugustaEngineeringDepart ment Cover Memo
Item # 21
(AED)toaccepttheproposalfromEMCEngineeringt oprovide
designandregulatorypermittingprofessionalservi cesforRocky
CreekBasin&FloodHazardMitigationprojectinth eamountof
$350,000,subjecttoreceiptofsignedprofessional services
contract.2)Donotapprove
Recommendation:ApproveAlternativeNumberOne.
FundsareAvailable
intheFollowing
Accounts:
SPLOSTPHASEIVPROJECTBUDGET324-04-
1110/209824002
REVIEWEDANDAPPROVEDBY :
Finance.
Procurement.
Law.
Administrator.
ClerkofCommission
Cover Memo
Item # 21
Attachment number 1
Page 1 of 8
Item # 21
Dr. Malik
June 17, 2011
Page 2
We will also furnish additional services at your request, such as:
¾ Aerial Mapping
¾ Environmental Site Assessments,
¾ Bidding and Construction Phase Services,
¾ Traffic Analyses and Studies
Reimbursable expenses incurred in connection with all basic and additional services will include
application and regulatory fees and compensatory mitigation and overnight delivery costs.
We are prepared to begin our services promptly after receipt of your acceptance of this
Proposal/Agreement and to complete our services in accordance with the attached schedule. This
schedule includes submittal of final construction documents and permit applications to regulatory
agencies but not their final review and approval time. It is our belief that the regulatory review
process will take approximately six months, but we cannot warrant or guarantee regulatory time
frames.
We look forward to working with Augusta-Richmond County. Should you have any questions with
regard to the scope or fee estimate please feel free to call.
Sincerely,
Robert L. Titus, P.E.
Augusta Branch Manager
Attachments
([KLELW³$´± Scope of Work
Preconstruction Time Schedule
Attachment number 1
Page 2 of 8
Item # 21
Dr. Malik
June 17, 2011
Page 3
ROCKY CREEK DRAINAGE BASIN & FLOOD HAZARD MITIGATION
EXHIBIT ³$´ ± SCOPE OF WORK
The project consists of a multiuse engineered flood management facility serving as a flood control
recreational water body that supports recreational facilities, sport fishing, and environmental
resources/benefit located in the Rocky Creek Drainage Basin near Gordon Highway and
Milledgeville Road in Augusta.
The proposed facility will serve as a regional flood hazard mitigation facility and recreational water
body for the surrounding neighborhoods. The project goals are to minimize flood hazards, promote
redevelopment of surrounding properties and improved neighborhood recreational activities.
(0& (QJLQHHULQJ 6HUYLFHV¶Scope of Work will include concept development, preliminary
engineering, right of way acquisition services, and final construction documents as further
described below.
Concept Development
EMC will gather pertinent data from existing sources and use them to create an existing conditions
base map for use in developing a concept for the project. This will include the US Army COE
Rocky Creek Study including the digital copies of the HEC-HMS and HEC-RAS programs. Other
sources of information will include the FEMA Studies, City of Augusta Sustainable Development
Guidelines and other regional planning studies along with existing topographic maps, utility plans,
and property plats.
EMC will perform limited field topographic surveys consisting of cross sections of the creek and
adjacent floodplain to supplement the existing conditions base map.
EMC will develop a stormwater model to simulate the existing conditions along Rocky Creek in the
project area and the proposed conditions with the addition of a flood control/recreational lake. (0&ZLOOXVH(3$¶V6WRUP:DWHU0DQDJHPHQW0RGHO 6:00 WRSHUIRUPWKHVHVLPXODWLRQVXVLQJ
hydrological and hydraulic information from the USACE HEC-HMS and HEC- RAS models.
Additional cross sectional information from our existing conditions base map and field surveyed
cross sections will be used to supplement their initial sections.
EMC will develop and simulate two alternate methods of providing a flood hazard mitigation facility
and recreational water body using SWMM to determine their effectiveness. This will include a lake
in-line with the existing creek and one where the existing creek is off-line.
EMC will conduct a ³GDP´EUHDNDQDO\VLV utilizing SWMM and field reconnaissance information on
downstream habitable structures (up to one mile) that could be flooded by such an event.
EMC will prepare conceptual layouts of the proposed alternatives utilizing the existing conditions
data base map and the results of the modeling.
(0&¶V HQYLURQPHQWDO FRQVXOWDQW 5HVRXUFH DQG /DQG &RQVXOWDQWV 5/& ZLOl utilize these
conceptual layouts to prepare an Environmental Impact and Permitting Assessment for the project.
This report will quantify the impacts that the proposed project would have on the environment,
Attachment number 1
Page 3 of 8
Item # 21
Attachment number 1
Page 4 of 8
Item # 21
Dr. Malik
June 17, 2011
Page 5
EMC will prepare Transportation and Utility Impacts Assessments that quantify the impacts to the
existing street network and water, sewer, gas, and electric utilities.
EMC will prepare a conceptual construction cost estimate for the proposed project.
EMC will present this completed concept to the City at the final concept meeting. EMC will prepare
minutes of the meeting and comments from the City will be incorporated into the final concept
plans.
EMC will provide copies of the final concept plans and reports to the regulatory agencies for their
review and comment prior to initiation of the construction documents. This will include the USACE,
EPD Safe Dams, and FEMA.
EMC will prepare presentation drawings and materials and attend up to two public information
meetings on the project.
Preliminary Engineering
(0&¶VFRQVXOWDQW5/&ZLOOdelineate all jurisdictional waters within the project area in accordance
with the regulatory requirements of 33 CFR Part 328 Definition of Waters of the U.S., the Corps of
Engineers Wetland Delineation Manual; January 1987. RLC will also complete a State Waters
determination within the project area to confirm the presence or absence of State Waters.
EMC will locate and plat the delineation for final verification from the USACE and the Local Issuing
Authority (LIA).
(0&¶VFRQVXOWDQW5/&ZLOOSUHSDUHDRequest for Jurisdictional Determination and submit this
request to the USACE for verification of the limits of jurisdiction; will coordinate with the LIA or EPD
for written confirmation of the presence or absence of state waters and a 25-foot state waters
buffer; and provide ongoing coordination with the appropriate regulatory agencies in order to obtain
final written verification of the limits of jurisdiction. If a field inspection of the delineation is
requested by the respective agencies, RLC will accompany agency personnel to the subject
property to support the delineation.
(0&¶VFRQVXOWDQW5/&ZLOOUHYLHZDOODYDLODEOHUHFRUGVWRJDWKHULQIRUPDWLRQUHJDUGLQJNQRZQ
occurrences of state and federally protected species listed within Augusta, Richmond County,
Georgia; conduct a thorough pedestrian survey of the entire project corridor to determine the
presence and/or absence of habitat suitable to sustain listed species; and prepare a report of
findings documenting the results of the survey.
(0&¶VFRQVXOWDQW5/&ZLOOSUHSDUHDpre-construction notification requesting authorization under
Nationwide Permit program to impact jurisdictional waters of the U.S. if it is determined that the
project will require this type of permit from the USACE. This task includes preparation of the
required paperwork and attendance at agency meetings as necessary to discuss the project and
matters relating to the permit application.
(0&¶VFRQVXOWDQW5/& ZLOOSUHSDUHDQ Individual Permit application for submittal to USACE if
required. This task includes preparation of the permit application, project justification, development
Attachment number 1
Page 5 of 8
Item # 21
Dr. Malik
June 17, 2011
Page 6
of a compensatory mitigation plan, response to comments received during the public notice and
attendance at agency meetings as necessary to discuss this project and matters relating to the
permit application. If required by USACE, the applicant must provide site selection criteria that will
be included in the alternative analysis that is required as part of the Clean Water Act Section
404(b) (1) guidelines.
(0&¶V FRQVXOWDQW 5/& ZLOO SUHSDUH DQG VXEPLW DBuffer Variance application requesting
authorization to perform land disturbance activities within the 25-foot buffer area, if required, in
accordance with the Georgia Erosion and Sedimentation Control Rules, 391-3-7, promulgated
under the Georgia Erosion and Sedimentation Act (Act), O.C.G.A. 12-7.
(0&¶V FRQVXOWDQW (&6 6RXWKHDVW //& (&6 ZLOO SHUIRUP JHRWHFKQLFDO LQYHVWLJDWLRQV LQ WKH
project area to determine soil profiles and structural characteristics. Soil borings will be spaced
and extended to a depth sufficient to design the proposed lake dam and provide for stable side
slopes along the lake. ECS will prepare a Geotechnical & Foundation Recommendation Report
that summarizes the findings of their investigations.
EMC will perform field surveys as necessary to prepare construction working drawings including
property corners, topographic information, existing utilities, and environmental features
EMC will prepare existing conditions database plans utilizing AutoCad 2009 that indicate property
lines, easements and right of ways; buildings, roadways, drainage systems, utilities, and other
improvements; adjacent building finish floor elevations; and contours at one-foot intervals.
EMC will provide these completed database plans to affected utility companies to identify/verify the
horizontal and vertical location of all their subsurface utilities in the project area.
EMC will prepare Preliminary Construction Plans for the project consisting of the following:
¾ Site Plan ± Water Body and Recreational Features
¾ Site Grading and Drainage plans
¾ Dam Plan and Sections
¾ Site Cross Sections
EMC will update the conceptual construction cost estimate and prepare outline specifications
based on the preliminary plans.
EMC will present these preliminary plans to the City in a milestone meeting for their review and all
comments will be addressed.
Right of Way Acquisition Services
EMC will prepare a Property Acquisition Map showing all properties being impacted by the
proposed project.
EMC will submit this map to the City for their review in a milestone meeting and for their initial
appraisal work in acquiring the necessary right of way for the project.
Attachment number 1
Page 6 of 8
Item # 21
Dr. Malik
June 17, 2011
Page 7
EMC will prepare individual property acquisition plats for recording when directed by the City.
EMC will stake the proposed right of way and/or easements with wood flags during the property
negotiation phase and iron rods prior to final acquisition.
Final Construction Documents
EMC will prepare the final construction working drawings sufficient for bidding by the City based
upon the approved preliminary plans. Drawings will include, but are not limited to, the following:
¾ Cover
¾ General Notes and Legend
¾ Site/Staking Plans
¾ Grading and Drainage Plans
¾ Dam Plan and Sections
¾ Stage Construction Plans
¾ Landscape Plan
¾ Irrigation Plan
¾ Phased Erosion Control Plans
¾ Erosion Control Notes and Details
¾ Earthwork Cross Sections
¾ Construction Details
EMC will prepare construction specifications, cost estimate, and time schedule.
EMC will present these final plans, specifications, and estimates to the City in a milestone meeting
for their review and all comments will be addressed.
EMC will develop all normal designs, calculations, and computations required for regulatory
approval.
EMC will prepare applications and accompanying documents, submit, and follow up through
approval for construction plan approval by the USACE.
EMC and ECS will prepare applications and accompanying documents, submit, and follow up
through approval for construction plan approval by the EPD Safe Dams Unit. This will include
retaining a third party plan reviewer approved by EPD to expedite the review period.
EMC will prepare and submit a Letter of Map Amendment (LOMA) and accompanying documents
to FEMA for the area impacted by the water body and follow up through its issuance.
EMC will attend monthly status meetings with the client and all public meetings and prepare
anticipated filings required in the course of normal permit approvals.
EMC will provide final construction documents in digital and paper copies to the City for their use in
bidding the project.
Attachment number 1
Page 7 of 8
Item # 21
ID Task Name
1 Concept Development
2 Data Collection & Base Map Preparation
3 Hydrological and Hydraulic Modeling
4 Initial Regulatory Reviews & Meetings
5 Concept Report and Plan
6 Preliminary Engineering
7 Environmental Services
8 Geotechnical Services
9 Surveying
10 Preliminary Construction Plans
11 Right of Way Acquisition
12 Final Construction Documents & Permitting
7/11 8/11 9/11 10/11 11/11 12/11 1/12 2/12 3/12 4/12 5/12 6/12 7/12
Preconstruction Time Schedule Rocky Creek Flood Hazard Mitigation Project EMC Engineering Services
Page 1
Item # 21
CPB# N/A
Augusta-Richmond County, Georgia
BE IT ORDAINED by the Commission-Council of Augusta-Richmond County,
Georgia that the following Capital Project Budget is hereby authorized:
Section 1: The project is authorized for Capital Project Budget for the Rocky Creek Drainage Basin &
Flood Hazard Mitigation in the amount of $350,000 to award the design services to
EMC Engineering subject to receipt of signed contract as requested by the AED.
Funding is available in the SPLOST Phase IV Fund Balance and SPLOST Phase VI.
Section 2: The following revenues are anticipated to be available to the Consolidated
Government to complete the project.
Special 1% Sales Tax, Phase IV 3,621,900$
Special 1% Sales Tax, Phase VI 3,500,000$
7,121,900$
Section 3: The following amounts are appropriated for the project:
By Basin By District
Raes Creek $7,121,900 7th $7,121,900
Section 4: Copies of this Capital Project Budget shall be made available to the
Comptroller for direction in carrying out this project.
Adopted this ____________________ day of ______________________.
Approved
_________________________________________________
Original-Commission Council Office
Honorable Deke Copenhaver, Mayor
CAPITAL PROJECT BUDGET
ROCKY CREEK DRAINAGE BASIN
& FLOOD HAZARD MITIGATION
Please do not process this document. Once approved by the Commission the original will be sent to the Clerk of Commission for
execution. For information reference this request, contact Engineering at ext 5070. Thanks
1 of 3 6.22.2011
Attachment number 2
Page 1 of 3
Item # 21
CPB# N/A
Augusta-Richmond County, Georgia
CAPITAL PROJECT BUDGET
ROCKY CREEK DRAINAGE BASIN
& FLOOD HAZARD MITIGATION
Copy-Engineering Department
Copy-Finance Department
Copy-Procurement Department
2 of 3 6.22.2011
Attachment number 2
Page 2 of 3
Item # 21
CPB# N/A
Augusta-Richmond County, Georgia
CAPITAL PROJECT BUDGET
ROCKY CREEK DRAINAGE BASIN
& FLOOD HAZARD MITIGATION
CPB AMOUNT CPB NEW
SOURCE OF FUNDS CPB CHANGE CPB
SPECIAL 1% SALES TAX, PHASE IV
FUND BALANCE $3,621,900 $0 $3,621,900
SPECIAL 1% SALES TAX, PHASE VI
000-0000-0000000 $3,500,000 $3,500,000
TOTAL SOURCES: $7,121,900 $0 $7,121,900
USE OF FUNDS
ENGINEERING
324-04-1110-5212115- $500,000 $0 $500,000
CONTINGENCY
324-04-1110-6011110- $6,621,900 $0 $6,621,900
TOTAL USES: $7,121,900 $0 $7,121,900
3 of 3 6.22.2011
Attachment number 2
Page 3 of 3
Item # 21
REQUEST FOR QUALIFICATIONS
Request for Qualifications will be received at this office until Wednesday, December 29, 2010 @ 3:00
p.m. FOR FURNISHING:
RFQ ITEM #10-199 Rocky Creek Drainage Basin & Flood Hazard Mitigation and
Improvements for Engineering Department
RFQs will be received by: The Augusta Commission hereinafter referred to as the OWNER at the offices of:
Geri A. Sams, Director
Augusta Procurement Department
530 Greene Street - Room 605
Augusta, Georgia 30901
RFQ documents may be examined at the office of the Augusta, GA Procurement Department, 530 Greene Street
– Room 605, Augusta, GA 30901. A Mandatory Pre-Qualification Conference will be held on Friday,
December 10, 2010 @ 10:00 a.m. in the Procurement Department – Room 605. A mandatory site visit will
follow. All questions must be submitted in writing to the office of the Procurement Department by
Tuesday, December 14, 2010 @ 5:00 p.m. by fax at 706-821-2811 or by mail. No RFQ will be accepted by
fax, all must be received by mail or hand delivered.
The local bidder preference program is applicable to this project. To be approved as a local bidder and
receive bid preference on an eligible local project, the certification statement as a local bidder and all
supporting documents must be submitted to the Procurement Department with your bonafide bid
package.
No RFQ may be withdrawn for a period of 90 days after time has been called on the date of opening.
An invitation for bids shall be issued by the Procurement Office and shall include specifications
prepared in accordance with Article 4 (Product Specifications), and all contractual terms and conditions,
applicable to the procurement. All specific requirements contained in the invitation to bid including, but
not limited to, the number of copies needed, the timing of the submission, the required financial data,
and any other requirements designated by the Procurement Department are considered material
conditions of the bid which are not waiveable or modifiable by the Procurement Director. Please mark
RFQ number on the outside of the envelope.
Bidders are cautioned that sequestration of RFQ documents through any source other than the office of the
Procurement Department is not advisable. Acquisition of RFQ documents from unauthorized sources places the
bidder at the risk of receiving incomplete or inaccurate information upon which to base his qualifications.
Disadvantage Business Enterprise (DBE) Augusta-Richmond County, Georgia does not operate a DBE,
MBE or WBE Program for Augusta funded projects, as a Federal Court has entered an Order enjoining the
Race-Based portion of Augusta’s DBE Program. Instead Augusta operates a Local Small Business
Opportunity Program. However, for various projects utilizing the expenditure of State or Federal funds,
Augusta enforces DBE requirements and/or DBE goals set by the Federal and/or State Agencies in
accordance with State and Federal laws.
GERI A. SAMS, Procurement Director
Publish:
Augusta Chronicle November 18, 25, December 2, 9, 2010
Metro Courier November 24, 2009
cc: Tameka Allen Interim Deputy Administrator
Abie Ladson Engineering Department
Hameed Malik Engineering Department
Attachment number 3
Page 1 of 1
Item # 21
VENDORS Attachment B Bidders Form Original 6 Copies
CRANSTON ENGINEERING
452 ELLIS STREET
AUGUSTA GA 30901
YES YES YES YES
EMC ENGINEERING
4106 COLBEN BLVD SUITE 105
EVANS, GA 30809
YES YES YES YES
THOMAS & HUTTON ENGINEERING
POST OFFICE BOX 2727
SAVANNAH GA 31402-2727
YES YES YES YES
W K DICKSON
1450 GREENE STREET SUITE 225
AUGUSTA GA 30901 YES YES YES YES
W R TOOLE ENGINEERS
1005 BROAD STREET SUITE 200
AUGUSTA GA 30901 YES YES YES YES
ZEL ENGINEERS
435 TELFAIR STREET
AUGUSTA GA 30901 YES YES YES YES
EAGLE UTILITY CONSTRUCTION
1350 BRANCH ROAD
BISHOP GA 30621
FLORENCE & HUTCHESON
1300 RIDENOUR BLVDM SUITE 310
KENNESAW GA 30152
HANES GEO COMPONENTS
3105 SWEETWATER ROAD STE 200
LAWRENCEVILLE GA 30044
HARRIS TRUCKING
PO BOX 14311
AUGUSTA GA 30909
KISINGER CAMPO
1720 PEACHTREE NW STE 1048
ATLANTA GA 30309URS CORPORATION
400 NORTHPARK TOWN CENTER
1000 ABERNATHY ROAD NE
ATLANTA GA 30328
RFQ Item #10-199
Rocky Creek Drainage Basin & Flood Hazard Mitigation
For the City of Augusta - Engineering Department
RFQ Opening Date: Wednesday, December 29, 2010 at 3:00 p.m.
Page 1 of 1
Attachment number 4
Page 1 of 1
Item # 21
Evaluation Criteria PTS
CRANSTON ENGINEERING
452 ELLIS STREET
AUGUSTA GA 30901
EMC ENGINEERING
4106 COLBEN BLVD SUITE
105
EVANS, GA 30809
THOMAS & HUTTON
ENGINEERING
POST OFFICE BOX 2727
SAVANNAH GA 31402-2727
W K DICKSON
1450 GREENE STREET
SUITE 225
AUGUSTA GA 30901
W R TOOLE ENGINEERS
1005 BROAD STREET SUITE
200
AUGUSTA GA 30901
ZEL ENGINEERS
435 TELFAIR STREET
AUGUSTA GA 30901
1) Qualifications of Company 20 17.0 18.3 16.3 17.0 15.7 16.0
2) Qualifications of Key Personnel that will
actually perform the design and permitting
services
25 20.0 20.0 17.0 19.3 15.0 17.0
3) Experience on similar Georgia projects 15 13.3 13.7 13.0 11.7 8.7 9.3
4) Experience in UACE 404 individual and Safe
Dam Permitting 15 8.7 13.3 9.3 8.0 8.0 8.7
5) References including specific individuals,
address, phone number, and e-mail address 10 8.3 9.0 8.3 8.3 8.3 8.3
5) Proximity to Augusta
(5 points)
- Within August-Richmond
County - 5
- Within the CSRA - 4
- Within Georgia - 3
- Within SE United States
(includes AL, TN, NC,
SC, FL) - 2
- All Others - 1
5 5.0 4.0 3.0 5.0 5.0 5.0
Total 90 72.3 78.3 67.0 69.3 60.7 64.3
Cumulative Evaluation Sheet
RFQ Item #10-199 Rocky Creek Drainage Basin & Flood Hazard Mititgation
for the City of Augusta - for Engineering Department
RFP Due: Thursday, January 20, 2010 @ 10:00 a.m.
Comments:
Item # 21
Attachment number 6
Page 1 of 1
Item # 21
Attachment number 7
Page 1 of 2
Item # 21
Attachment number 7
Page 2 of 2
Item # 21
Attachment number 8
Page 1 of 6
Item # 21
Attachment number 8
Page 2 of 6
Item # 21
Attachment number 8
Page 3 of 6
Item # 21
Attachment number 8
Page 4 of 6
Item # 21
Attachment number 8
Page 5 of 6
Item # 21
Attachment number 8
Page 6 of 6
Item # 21
Attachment number 9
Page 1 of 2
Item # 21
Attachment number 9
Page 2 of 2
Item # 21
Attachment number 10
Page 1 of 1
Item # 21
CommissionMeetingAgenda
8/2/20115:00PM
WebsterDetentionCenterPhaseIIDesignServices
Department:TomBeck,Recreation,ParksandFacilitiesDepartme nt
Caption:Motionto approvetheselectioncommittee’srecommendationto
issueacontracttoJohnson,Laschober&Associates ,P.C.for
ProfessionalDesignServicesfortheNewWebsterDe tention
Center,PhaseII.(ApprovedbyEngineeringServices
CommitteeJuly25,2011)
Background:RequestsforQualifications(RFQ's)werepreparedt osolicit
qualificationsstatementsandproposalsforProfess ionalDesign
ServicesfortheNewWebsterDetentionCenter,Phas eII.
Analysis:Six(6)compliantresponsesforPhaseIqualificati onssubmittals
werereceivedandevaluatedbytheselectioncommit tee.Ashort
listoffour(4)firmswasselectedtoparticipate inthePhaseII
interviews.AftercompletingandscoringthePhase IIInterviews,
thefeesforProfessionalDesignServiceswereopen edandscored
accordingtothescoringmatrixincludedinthePha seIIsubmittal
requirement.Theselectioncommitteehascompletedt he
evaluationofthePhaseIandPhaseIIsubmittalsf romthe
ArchitecturalFirmsandherebyrecommendsthataco ntractshould
beissuedtoJohnson,Laschober&Associates,P.C.intheamount
of$497,200.00
FinancialImpact:Thetotalamountof$497,200.00forProfessionalAr chitectural
Servicesfeesisincludedintheoverallprojectbu dgetof
$16,990,000.00
Alternatives:1.Approvetheselectioncommittee’srecommendation toissuea
contracttoJohnson,Laschober&Associates,Inc.f orProfessional
DesignServicesfortheNewWebsterDetentionCente r,PhaseII.
2.Selectadifferentmethodofprocuringthedesig nservicesand
awardthetotalcontracttoalumpsumbidder,whic hwilldelay
thecompletiondateoftheprojectandincreasethe totalproject
costs.
Recommendation:Approvetheselectioncommittee’srecommendationto issueaCover Memo
Item # 22
contracttoJohnsonLaschober&Associates,P.C.fo rProfessional
DesignServicesfortheNewWebsterDetentionCente r,PhaseII.
FundsareAvailable
intheFollowing
Accounts:
GL–328-03-1130;JL-210356004
REVIEWEDANDAPPROVEDBY :
Finance.
Procurement.
Law.
Administrator.
ClerkofCommission
Cover Memo
Item # 22
Attachment number 1
Page 1 of 1
Item # 22
REQUEST FOR QUALIFICATIONS
Request for Qualifications will be received at this office until Thursday, April 21, 2011 @ 11:00 a.m. FOR
FURNISHING:
RFQ Item #11-104 Professional Design Services for the New Webster Detention Center
Phase II for Public Service Department
RFQs will be received by: The Augusta Commission hereinafter referred to as the OWNER at the offices of:
Geri A. Sams, Director
Augusta Procurement Department
530 Greene Street - Room 605
Augusta, Georgia 30901
RFQ documents may be viewed on the Augusta Richmond County web site under the Procurement Department
ARCbid. RFQ documents may be examined at the office of the Augusta, GA Procurement Department, 530
Greene Street – Room 605, Augusta, GA 30901. All questions must be submitted in writing to the office of
the Procurement Department by Monday, April 4, 2011 @ 5:00 p.m. by fax at 706-821-2811 or by email @
procbidandcontract@augustaga.gov. No RFQ will be accepted by fax, all must be received by mail or hand
delivered.
The local bidder preference program is applicable to this project. To be approved as a local bidder and
receive bid preference on an eligible local project, the certification statement as a local bidder and all
supporting documents must be submitted to the Procurement Department with your bonafide bid
package.
No RFQ may be withdrawn for a period of 90 days after time has been called on the date of opening.
An invitation for bids shall be issued by the Procurement Office and shall include specifications prepared in
accordance with Article 4 (Product Specifications), and all contractual terms and conditions, applicable to the
procurement. All specific requirements contained in the invitation to bid including, but not limited to, the number
of copies needed, the timing of the submission, the required financial data, and any other requirements
designated by the Procurement Department are considered material conditions of the bid which are not waiveable
or modifiable by the Procurement Director. Please mark RFQ number on the outside of the envelope.
Bidders are cautioned that sequestration of RFQ documents through any source other than the office of the
Procurement Department is not advisable. Acquisition of RFQ documents from unauthorized sources places the
bidder at the risk of receiving incomplete or inaccurate information upon which to base his qualifications.
Funding for this project may include federal funds provided by the U. S. Department of Transportation
(DOT) and/or other federal agencies. All DOT funded projects are subject to the requirements of 49 CFR
Part 26. These requirements are mandatory and non-negotiable. Augusta enforces Disadvantage
Business Enterprise (DBE) requirements and/or DBE goals set by Federal and/or State Agencies in
accordance with State and Federal laws. Please be advised that the U. S. District Court for the Southern
District of Georgia has entered on Order enjoining the Race-Based portion of Augusta, Georgia’s DBE
Program. Thus, Augusta, Georgia does not have or operate a DBE, MBE or WBE Program for projects (or
portions of projects) having Augusta, Georgia as the source of funding.
GERI A. SAMS, Procurement Director
Publish:
Augusta Chronicle March 10, 17, 24, 31, 2011
Metro Courier March 16, 2011
cc: Tameka Allen Interim Deputy Administrator
Mike Greene Public Service
Forrest White Heery International
Attachment number 2
Page 1 of 1
Item # 22
VENDORS Attachment B Bidders Form Addendum Original 8 Copies
2KM Architects
2275 Wrightsboro Road
Augusta, GA 30904
Yes Yes Yes Yes Yes
Dickinson Architects
771 Broad Street, Suite 200
Augusta, GA 30901
Yes Yes Yes Yes Yes
Johnson Laschober & Associates
1296 Broad Street
Augusta, GA 30901
Yes Yes Yes Yes Yes
KSGW Architects
2918 Professional Parkway, Suite 210
Augusta, GA 30907
Yes Yes Yes Yes Yes
Woodhurst Partners
607 – 15th Street
Augusta, GA 30901
Yes Yes Yes Yes Yes
Clemons Rutherford
2027 Thomasville Road, Ste 205
Tallahasse, FL 32308
Yes Yes Yes Yes Yes
Hughes, Beattie, O'Neil & Law
1201 Broad Street, Suite 2A
Augusta, GA 30901
Strollo Architects
718 Virginia Drive
Orlando, FL 32803
Studio 3 Design Group
1617 Walton Way
Augusta, GA 30904
A & S Engineering
P. O. Box 2413
Evans, GA 30809
AECOM
1360 Peachtree St Ne Ste 500
Atlanta GA 30309
Archetype Design
4860 Leisure Drive
Dunwoody, GA 30338
BRPH, Inc.
2000 Powers Ferry Rd., Suite 600
Marietta, GA 30067
Cheatham Fletcher Scott Architects
410 – 8th Street
Augusta, GA 30901
Clark Patterson Lee
350 Town Center Ave., Suite 201
Suwanee, GA 30024
CNNA Architects
119 Luckie Street, Nw – Suite 100
Atlanta, GA 30303
RFQ Item #11-104
Professional Design Services for the New Webster Detention Center (Phase II)
for the City of Augusta - Public Services Department
RFQ Due: Thursday, April 21, 2011 @ 11:00 a.m.
NON-COMPLIANT
Did not return Attachment B
Did not return Bidder's Form
Did not Acknowledge Addendum
NON-COMPLIANT
Attachment B missing E-Verify Number
Attachment B missing pages 1 & 2
Bidder's Form missing Business License Number
NON-COMPLIANT
Attachment B missing Notary Seal
Page 1 of 3
Attachment number 3
Page 1 of 3
Item # 22
VENDORS Attachment B Bidders Form Addendum Original 8 Copies
RFQ Item #11-104
Professional Design Services for the New Webster Detention Center (Phase II)
for the City of Augusta - Public Services Department
RFQ Due: Thursday, April 21, 2011 @ 11:00 a.m.
Cranston Engineering
Old Engine Co. No. 1 Bldg
452 Ellis Street
Augusta, GA 30901
Duke Edwards & Dukes
920 W Highland Avenue
Albany, GA 31701
EMC Engineering Services
4106 Colbern Blvd, Suite 105
Evans, GA 30809
Haines Gipson & Associates Inc
1550 N Brown Rd Ste 100
Lawrenceville GA 30043
HO & K
191 Peachtree St. Ne
Suite 4100
Atlanta, GA 30303
Hussey, Gay, Bell & Deyoung Int.
625 Green Street, Ne
Gainesville, GA 30501
Krafra
418 8th Street
Augusta, GA 30901
Lindsay, Pope, Brayfield, Clifford &
Associates, Inc.
344 West Pike Street
Lawrenceville, GA 30046
Lord, Aeck & Sargent
1201 Peachtree St, Ne Ste 300
Atlanta, GA 30361
MSTSD Inc
1776 Peachtree Rd Nw Ste 200 N
Atlanta GA 30309
Munger Associates Consulting
596 Links Lane
Martinez, GA 30907
P M & A Consulting Engineers
609 Broad Street
Augusta, GA 30901
PBS & J
5665 New Northside Dr. Suite 400
Atlanta, GA 30328
Pond & Company
3500 Parkway Lane, Suite 600
Norcross, GA 30092
Pruett Ford & Associates
1201 Broad Street
Augusta, GA 30901
Rosser International
524 W Peachtree St. NW
Atlanta, GA 30308
S. L. King Technologies
270 Peachtree St, NW, Stuite 1600
Atlanta, GA 30303 Page 2 of 3
Attachment number 3
Page 2 of 3
Item # 22
VENDORS Attachment B Bidders Form Addendum Original 8 Copies
RFQ Item #11-104
Professional Design Services for the New Webster Detention Center (Phase II)
for the City of Augusta - Public Services Department
RFQ Due: Thursday, April 21, 2011 @ 11:00 a.m.
Southern Partners
1233 Augusta West Parkway
Augusta, GA 30909
Stewart-Cooper-Newell
719 E. Second Avenue
GAstonia, NC 28504
T Y Lin International
260 Peachtree Street, Suite 900
Atlanta, GA 30303
The Polote Co.
1810 Mill B Lane
Savannah, GA 31405
TVS Design
2700 Promeanade Two
1230 Peachtree St., Ne
Atlanta, GA 30309
Virgo Gambill Architects
2531 Centerwest Parkway, Suite 200
Augusta, GA 30904
W. K. Dickson
1450 Greene St. Suite 225
Augusta, GA 30901
Warren Epstein & Associates
1785 Chesire Bridge Rd., NE
Atlanta, GA 30324
WR Toole Engineers
1005 Broad Street
Augusta, GA 30901
Page 3 of 3
Attachment number 3
Page 3 of 3
Item # 22
Attachment number 4
Page 1 of 1
Item # 22
Attachment number 5
Page 1 of 2
Item # 22
Attachment number 5
Page 2 of 2
Item # 22
Attachment number 6
Page 1 of 7
Item # 22
Attachment number 6
Page 2 of 7
Item # 22
Attachment number 6
Page 3 of 7
Item # 22
Attachment number 6
Page 4 of 7
Item # 22
Attachment number 6
Page 5 of 7
Item # 22
Attachment number 6
Page 6 of 7
Item # 22
Attachment number 6
Page 7 of 7
Item # 22
Augusta, Georgia
Design Services Evaluation
Phase II Scoring
Detail Cumulative - 11-104
Architect Summary RFP 11-104 Phase II Detail Cumulative
Category and Description Pts.
Project Architect 20 18.5 16.5 17.0 16.5
Project Manager 20 18.5 16.0 17.5 16.5
Mechanical Engineer 5 4.6 4.4 4.6 4.3
Electrical Engineer 5 4.5 4.4 4.6 4.3
Principal or Owner 5 4.6 4.3 4.3 4.0
Presentation 20 19.5 16.5 17.0 16.0
Q & A 10 9.3 8.8 9.0 8.3
Fee Proposal 15 0.0 9.0 12.0 15.0
Total Points 100 79.5 79.8 86.0 84.8
Comments:
Clemons Rutherford
2027 Thomasville, Road
Suite 205
Tallahasse, Florida 32308
Dickinson Architects
771 Broad Street
Suite 200
Augusta, Georgia 30901
Johnson Laschober & Associates
1296 Broad Street
Augusta, Georgia 30901
KSGW Architects
2918 Professional Parkway
Suite 210
Augusta, GA 30901
Item # 22
CommissionMeetingAgenda
8/2/20115:00PM
WindsorSpringRoad,SectionIV&V-SA9
Department:AbieL.Ladson,PE,CPESC,Director
Caption:Motionto authorizetheEngineeringDepartmenttoapproveCPB
#323-041110-299823786,ChangeNumberNine
andSupplementalAgreementNumberNinefromJacobs
EngineeringGroup,Inc.(JEG)intheamountof$37,141forthe
purposeofpreparinganewNoiseStudytocomplywi thGDOT
GuidelineswhichwentintoeffectJuly13,2011;pr eparean
EcologyAddendumwhichwillincorporatedeterminati onsof
watersofthestateinaccordancewithanEPDsitev isit;and
incorporatethesenewstudiesintotheenvironmenta ldocument
whichwillhavetobere-evaluatedandapprovedby theGeorgia
DepartmentofTransportation(GDOT)andFederalHig hway
Administration(FHWA)sostateandfederalfundsca nbeusedto
fundtherightofwayacquisitiononWindsorSpring RoadSection
V,ARCproject.Fundsareavailableintheprojec tengineering
account.(ApprovedbyEngineeringServicesCommitteeJuly
25,2011)
Background:ThisisaGDOTprojectthatwillwidenandreconstr uctWindsor
SpringRoadtofourlaneswitha19’raisedmed ianfromState
Route88inHephzibahtoTobaccoRoadandreplacet hebridges
overNorfolkSouthernRailroadandSpiritCreek.T he
EngineeringDepartmentisresponsiblefordevelopme ntofthe
preliminaryengineeringactivities.Theenvironment aldocument
coversSectionsIVandV.Theestimatedconstructio ncostfor
PhaseVis$13,235,553andconstructionfundingis currently
identifiedinfiscalyear2016.
Analysis:OnApril6,1999Augusta-RichmondCounty(ARC)ente redinto
anagreementwithGDOTwhichstatedthatARCwould be
responsibleforfundingandacquiringtherightof wayonSection
V.TherightofwayplansonSectionVwereapprove donAugust
13,2010.Thecurrentrightofwaycostestimateon SectionVis
$5,585,800andARChasapproximately$1millionava ilableto
spendontheacquisition.ARChasworkedwiththeA ugusta
MetropolitanPlanningOrganization(MPO)and$4,500 ,000has
beenaddedtotheirTransportationImprovementPlan (TIP)for
fiscalyears2012–2015andidentifiedtobespentforrightofway Cover Memo
Item # 23
acquisitiononSectionV.Therightofwayfundswi llbeavailable
infiscalyear2012(7/1/11–6/30/12).Inorderto receivethe
federalandstatefundsidentifiedfortherightof wayacquisition
intheMPOTIP,theenvironmentaldocumentwillhav etobere-
evaluatedandapprovedbyGDOTandFHWA.The
environmentaldocumentwasoriginallyapprovedonS eptember5,
2007andcoversSectionIVandSectionV.Theenvir onmental
documentmustbeupdatedtoincorporatethenewGDO TNoise
StudyguidelineswhichwentintoeffectonJuly13,2011and
addressdeterminationsofwatersofthestatefroma nEPDsite
visitonMarch23,2011.TheNoiseStudymustbeup datedto
complywiththenewGDOTguidelinesandNoiseAbate ment
CriteriaguidelinechangesasmandatedbyFHWA.The costto
completethistaskis$9,550.OnMarch23,2011rep resentatives
fromEPD,GDOTOfficeofEnvironmentalServicesand the
Consultantvisitedthecorridortolookatthewate rsofthestate
thathadpreviouslybeendetermined.EPDnotedmino rchangesto
thedeterminationsofwatersofthestateandthese changeswillbe
incorporatedintotheEcologyAddendumoftheenvir onmental
document.Thecosttocompletethistaskis$9,751.The
environmentaldocumentmustbeupdatedtoincludet henewnoise
criteriaandtheminorchangestothedetermination softhewater
ofthestate.Therevisedenvironmentaldocumentmu stbere-
evaluatedandapprovedbyGDOTandFHWAsorightof way
fundonSectionVcanbeauthorized.Thecosttoco mpletethis
taskis$17,360.Miscellaneousexpensestotal$480.
FinancialImpact:FundingisavailableinWindsorSpringRoad,Sectio nV
Right/WayaccounttobetransferredtotheSection Vengineering
account.
Alternatives:1.AuthorizetheEngineeringDepartmenttoapprove CPB#323-
041110-299823786,ChangeNumberNineandSupplement al
AgreementNumberNinefromJacobsEngineeringGroup ,Inc.
(JEG)intheamountof$37,141forthepurposeofp reparinga
newNoiseStudytocomplywithGDOTGuidelineswhic hwent
intoeffectJuly13,2011;prepareanEcologyAdden dumwhich
willincorporatedeterminationsofwatersofthest atein
accordancewithanEPDsitevisit;andincorporate thesenew
studiesintotheenvironmentaldocumentwhichwill havetobere-
evaluatedandapprovedbytheGeorgiaDepartmentof
Transportation(GDOT)andFederalHighwayAdministr ation
(FHWA)sostateandfederalfundscanbeusedtofu ndtherightof
wayacquisitiononWindsorSpringRoadSectionV,A RCproject.
Fundsareavailableintheprojectengineeringacco unt.2.Donot
approveandthetotalcostforacquiringtheright ofwayon
SectionVwillbetheresponsibilityofAugusta-Ric hmond
County.
Cover Memo
Item # 23
Recommendation:approvealternative1
FundsareAvailable
intheFollowing
Accounts:
323-041110-5212115/299823786-5212115
REVIEWEDANDAPPROVEDBY :
Finance.
Procurement.
Law.
Administrator.
ClerkofCommission
Cover Memo
Item # 23
(SA02 – For changes greater than $20,000) March 2010
AUGUSTA, GEORGIA
EGIEERIG DEPARTMET
SUPPLEMETAL AGREEMET
Augusta Richmond County Project Number(s): 323-041110-299823766 & 323-041110-299823786
GDOT Number (s): STP-7007 (6) & STP-1105 (4) PI 250610 & 254320
Supplemental Agreement Number: 9
Purchase Order Number: 53296
WHEREAS, We, Jacobs Engineering Group, Inc., Consultant, entered into a contract with Augusta-
Richmond County on June 27, 2001, for engineering design services associated with the improvements
to Windsor Spring Road Improvements Section IV & Section V, projects STP-7007 (6) & STP-1105 (4),
File Reference No. 11-014 (A), and
WHEREAS, certain revisions to the design requested by Augusta-Richmond County are not covered by
the scope of the original contract, we desire to submit the following Supplemental Agreement to-wit:
Noise Study Addendum to meet the new GDOT Guidelines, Ecology Study Addendum to
address determinations of state waters in accordance with EPD site visit, and revisions
to the approved environmental document to incorporate these addendums which will
enable Federal/State right of way funds to be used on Section V
It is agreed that as a result of the above described modification the contract amount is increased by
$37,141.00 from $2,596,029.71 to a new total of $2,633,170.71.
Any modifications to submittal dates shall be as identified in the attached proposal. This agreement in
no way modifies or changes the original contract of which it becomes a part, except as specifically stated
herein.
NOW, THEREFORE, We, Jacobs Engineering Group, Inc., Consultant, hereby agree to said Supplemental
Agreement consisting of the above mentioned items and prices, and agree that this Supplemental
Agreement is hereby made a part of the original contract to be performed under the specifications
thereof, and that the original contract is in full force and effect, except insofar as it might be modified by
this Supplemental Agreement.
This day of , 2011.
RECOMMEND FOR APPROVAL:
CITY OF AUGUSTA-RICHMOND COUNTY JACOBS ENGINEERING GROUP, INC.
AUGUSTA, GEORGIA
Mayor Deke S. Copenhaver
Approved Date: Approved Date:
[ATTACHED CORPORATE SEAL]
ATTEST: ATTEST:
Title: Title:
Please do not process this document. Once approved by the Commission the original will be sent to the Clerk of Commission
for execution. For information reference this request, contact Engineering at ext 5070. Thanks
Attachment number 1
Page 1 of 1
Item # 23
Augusta-Richmond County, Georgia
BE IT ORDAINED by the Commission-Council of Augusta-Richmond County,
Georgia that the following Capital Project Budget is hereby adopted:
Section 1: This project is authorized to CPB#323-041110-299823786 and SA#9. The funding for this project in
amount of $37,141.00 is needed for the Noise Study Addendum to comply with GDOT Guidelines
into effect July 13, 2011. Funding for this request will be transferred from the project Section V
Right of Way Account to the Section V project Engineering Account.
Section 2: The following revenues are anticipated to be available to the Consolidated
Government to complete the project.
Special 1% Sales Tax, Phase III 1,560,500$
Special 1% Sales Tax, Phase IV 600,000$
2,160,500$
Section 3: The following amounts are appropriated for the project:
By Basin By District
4th, 6th, & 8th 2,160,500$
Section 4: Copies of this Capital Project Budget shall be made available to the
Comptroller for direction in carrying out this project.
Adopted this ____________________ day of ______________________.
Approved
_________________________________________________
Original-Commission Council Office
Copy-Engineering Department
Copy-Finance Department
Copy-Procurement Department
CPB#323-041110-299823786
CAPITAL PROJECT BUDGET
WINDSOR SPRING ROAD IMPROVEMENTS, SECTION IV
(WILLIS FOREMAN RD TO TOBACCO RD)
CHANGE NUMBER NINE
McBean/Spirit Crk $ 2,160,500
Honorable, Deke Copenhaver, Mayor
Please do not process this document. Once approved by the Commission the original will be sent to the Clerk of Commission for execution. For information reference this request, contact Engineering at
ext 5070. Thanks
1 of 2 01/11/2010
Attachment number 2
Page 1 of 2
Item # 23
Augusta-Richmond County, Georgia CPB#323-041110-299823786
CAPITAL PROJECT BUDGET
WINDSOR SPRING ROAD IMPROVEMENTS, SECTION IV
(WILLIS FOREMAN RD TO TOBACCO RD)
CHANGE NUMBER NINE
CPB AMOUNT CPB NEW
SOURCE OF FUNDS CPB CHANGE CPB
SALES TAX, PHASE III
323041110-000000-299823786 ($1,000)($1,000)
SALES TAX, PHASE III
323041110-000000-299823786 ($1,559,500) ($1,559,500)
SPECIAL 1% SALES TAX, PHASE IV
324041110-000000-202824786 ($600,000) ($600,000)
TOTAL SOURCES: ($2,160,500) ($2,160,500)
USE OF FUNDS
ADVERTISING
323041110-5233119-299823786 $1,000 $1,000
ENGINEERING
323041110-5212115-299823786 $1,211,498 $37,141 $1,248,639
RIGHT OF WAY
323041110-5411120-299823786 $888,502 ($37,141) $851,361
UTILITIES323041110-5414510-299823786 $50,000 $50,000
SIGNAL
323041110-5414610-299823786 $5,000 $5,000
CONTINGENCY
323041110-6011110-299823786 $4,500 $4,500
TOTAL USES:$2,160,500 $2,160,500
2 of 2 01/11/2010
Attachment number 2
Page 2 of 2
Item # 23
CommissionMeetingAgenda
8/2/20115:00PM
Minutes
Department:ClerkofCommission
Caption:Motionto approvetheminutesoftheregularmeetingofthe
Commissionheld July19,2011and LegalMeetingheld July25,
2011.
Background:
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 24
CommissionMeetingAgenda
8/2/20115:00PM
Appointmentsto2011RedistrictingCommittee
Department:ClerkofCommission
Caption:AppointmentofCommissionrepresentativetothe201 1
RedistrictingCommittee.(RequestedbyMayorCopenhaver)
Background:
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 25
CommissionMeetingAgenda
8/2/20115:00PM
CSRAEOA
Department:
Caption:Motionto approve therecommendationfromtheCSRAEOAto
appointBrendaBonner.
Background:
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 26
Attachment number 1
Page 1 of 2
Item # 26
Attachment number 1
Page 2 of 2
Item # 26
CommissionMeetingAgenda
8/2/20115:00PM
DFACSBoard
Department:
Caption:Motionto approvetherecommendationsofthe(Augusta)
DepartmentofFamily&ChildrenServicesBoardtor eappointDr.
ThomasGardinerandMr.JamesKendrick.
Background:
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 27
Attachment number 1
Page 1 of 2
Item # 27
Attachment number 1
Page 2 of 2
Item # 27
CommissionMeetingAgenda
8/2/20115:00PM
Sheriff'sMeritBoard
Department:
Caption:Motionto approvetherecommendationsfromtheSheriff's
Departmenttoappoint DanWeigle replacing RussellMalone and
QuincyRobertson replacing DanielCross ,Sr.totheRichmond
CountySheriff'sMeritBoard.(RequestedbyCommissionerJoe
Jackson)
Background:
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 28
Attachment number 1
Page 1 of 1
Item # 28
Attachment number 2
Page 1 of 1
Item # 28
Attachment number 3
Page 1 of 1
Item # 28
CommissionMeetingAgenda
8/2/20115:00PM
Affidavit
Department:ClerkofCommission
Caption:Motionto authorizeexecutionbytheMayoroftheaffidavitof
compliancewithGeorgia'sOpenMeetingAct.
Background:
Analysis:
FinancialImpact:
Alternatives:
Recommendation:
FundsareAvailable
intheFollowing
Accounts:
REVIEWEDANDAPPROVEDBY :
Cover Memo
Item # 29