The URL can be used to link to this page

Home My WebLink About2009-03-17-Meeting Agenda Commission Meeting Agenda Commission Chamber 3/17/2009 12:00 PM INVOCATION: Reverend Timothy R. Green, Pastor Jenkins Memorial CME Church. PLEDGE OF ALLEGIANCE TO THE FLAG OF THE UNITED STATES OF AMERICA. PRESENTATION(S) A. Buffalo Soldiers. RE: Donation to Augusta Recreation and Parks Department in the amount of $2000.00. Attachments RECOGNITION(S) Don Grantham B. Congratulations! Commissioner Don Grantham for completing all course work required for certificate of recognition from the University of Georgia and the Association County Commissioners. Attachments US Army C. Colonel Robert A. Prince, USAF, Retired and Command Sergeant Major Olin Dorsey, US Army Retired. (Requested by Commissioner Calvin Holland) Attachments Five (5) minute time limit per delegation DELEGATIONS D. Mr. Henry T. Armstrong,III., Augusta Partnership Specialist U.S. Census. RE: ARC 2010 Census Complete Count Committee Awareness Campaign. Attachments CONSENT AGENDA (Items 1-37) PLANNING 1. Z-09-06 – A request for concurrence with the Augusta-Richmond County Planning Attachments Commission to approve with the following conditions 1) the use of these properties be limited to a convenience store and for the sale of fireplaces and those uses allowed in a B-1 (Neighborhood Business) zone and 2) the work area of the fireplace business be buffered by a solid board fence; a petition by George Nabor requesting a change of zoning from Zone B-1 (Neighborhood Business) to Zone B-2 (General Business) affecting property containing .49 acres and is known under the present numbering system as 2053 Broad Street. (Tax Map 027-3 Parcels 075 and 075-01) DISTRICT 1 2. Z-09-11 - A request for concurrence with the Augusta-Richmond County Planning Commission to approve with the following conditions 1) that the manufactured home be placed a minimum of 100 feet off the right-of-way of Piney Grove Road and 2) that a 100 foot undisturbed natural buffer, except for the driveway, remain between the home and Piney Grove Road; a petition by Gloria Shelton, on behalf of Tiffany Shelton, requesting a change of zoning from Zone R-1B (One-family Residential) to Zone A (Agriculture) affecting property approximately1.53 acres and is know as 1178 Piney Grove Road. (Tax Map 338-0-030-00-0) DISTRICT 8 Attachments 3. FINAL PLAT – Townhomes of Windsor, Phase One – S -786-I - A request for concurrence with the Augusta-Richmond County Planning Commission to approve a petition from H. Lawson Graham & Associates, on behalf of Chris Johnson, requesting final plat approval for Townhomes of Windsor Phase 1. This residential townhome subdivision is located off Windsor Spring Road East of Nordahl Drive and contains 18 lots. Attachments PUBLIC SERVICES 4. Motion to approve a New Application: A. N. 09 - 69: request by Evelyn E. Pilgrim for an on premise consumption Beer license to be used in connection with Business Between Friends DBA My Friends Place located at 353 Highland Ave. There will be Sunday Sales. District 7. Super District 10. (Approved by Public Services Committee March 9, 2009) Attachments 5. Motion to approve New Application: A. N. 09 - 70: a request by Korey D. Williams for an on premise consumption Liquor, Beer & Wine license to be used in connection with Who's On First Bar & Grill located at 1524 Gordon Hwy. There will be Dance. District 2. Super District 9. (Approved by Public Services Committee March 9, 2009) Attachments 6. Motion to approve a request by Glen Brinson for a Sunday Sales license to be used in connection with 209 Music Lounge located at #4 8th St. There will be Sunday Sales. District 1. Super district 9. (Approved by Public Services Committee March 9, 2009) Attachments 7. Motion to approve a request by Chris T. Kuneman for a Sunday Sales license to be used in connection with Rack & Grill located at 3801 Mike Padgett Hwy. There will be Sunday Sales. District 8. Super District 10. (Approved by Public Services Committee March 9, 2009) Attachments 8. Motion to approve a request by Jan Scholer for a Special Events License for (5) five days April 7th thru April 11, 2009 for Masters Week to be used in connection with Wild Wing Cafe located 3035 Washington Rd. (In the parking lot) District 7. Super District 10. (Approved by Public Services Committee March 9, 2009) Attachments 9. Motion to approve a request by Melissa Ruiz for a Special Events License for (4) four days April 8th thru April 11, 2009 for Masters Week to be used in connection with Mi Rancho 2, Inc. located at 3064 Washington Rd. (In the parking lot). District 7. Super District 10. (Approved by Public Services Committee March 9, 2009) Attachments 10. Motion to approve additional funds not to exceed $50,000 to be used for the completion of a building addition to the Jamestown Community Center. (Approved by Public Services Committee March 9, 2009) Attachments ADMINISTRATIVE SERVICES 11. Motion to approve an Ordinance to amend Title Three of the Augusta, Georgia Code to add a definition for the term "Motorized Cart: to Section 3-5-1, to repeal all ordinances in conflict herewith, to provide an effective date and for other purposes. (Approved by Administrative Services Committee March 9, 2009) Attachments 12. Motion to approve an Ordinance providing for the demolition of certain unsafe and uninhabitable structures in the Olde Town Neighborhood: 422 Third Street, (District 1, Super District 9); Harrisburg Neighborhood: 2442 Lawton Street, 1967 Ellis Street, 1809-1811 Fenwick Street, 1711 Fenwick Street, 706 Moore Avenue, 1701-1703 Saint Luke Street, 1851 Wilhelm Lane, (District 1, Super District 9); AND WAIVE 2ND READING. (Approved by Administrative Services Committee March 9, 2009) Attachments PUBLIC SAFETY 13. Motion to approve Standard Software Maintenance Agreement with New World Systems, Inc. for the period covering January 1, 2009 - December 31, 2011. (Approved by Public Safety Committee March 9, 2009) Attachments 14. Motion to approve contract with Palatine Technology Group to provide software, hardware, and services related to Electronic Warrant Interchange. (Approved by Public Safety Committee March 9, 2009 Attachments 15. Motion to approve the acquisition of software and services related to the redundancy of the Sheriff's Office Jail and Records Hardware and Software. (Approved by Public Safety Committee March 9, 2009) Attachments FINANCE 16. Motion to approve abatement of 2008 County Ad Valorem Taxes on properties acquired by Augusta-Richmond County. (Approved by Finance Committee March 9, 2009) Attachments 17. Motion to approve the replacement of 4 pursuit type vehicles (Impalas) for the Marshal's Office and one vehicle (Impala) for the District Attorney's Office for 2009 from Capital Outlay funds. (Approved by Finance Committee March 9, 2009) Attachments 18. Motion to approve the replacement of three light pickup trucks for the Solid Waste Department. (Approved by Finance Committee March 9, 2009) Attachments 19. Motion to approve the replacement of 4 full size pickup trucks and 1 new sports utility vehicle for the Utilities Department-Administration & Engineering Division. (Approved by Finance Committee March 9, 2009) Attachments 20. Motion to approve the replacement of 4 compact pickup trucks and 2 utility body trucks for the Utilities Department-Customer Service Division (Approved by Finance Committee March 9, 2009) Attachments 21. Motion to approve the replacement of 6 compact pickup trucks of the Utilities Department, Water Production and Construction and Maintenance Divisions. (Approved by Finance Committee March 9, 2009) Attachments 22. Motion to approve Memorandum of Understanding with Clean Augusta Downtown Initiative, Inc. with quarterly payments and a 2% administrative fee to be collected on the amount that was advanced. (Approved by Finance Committee March 9, 2009) Attachments 23. Motion to approve request for extension of TMA Contract. (Approved by Finance Attachments Committee March 9, 2009) 24. Motion to approve the recommendation of the Tax Assessor regarding a request from Ms. Janet Trail for a partial refund of taxes for the years of 2006 through 2008 on property located at 1502 Gordon Highway. (Approved by Finance Committee March 9, 2009) Attachments 25. Motion to approve Excess Worker’s Compensation Insurance with Safety National Casualty Insurance with Statutory Limits and a $600,000 SIR (self insured retention; otherwise, known as the deductible) for a deposit premium of $164,848. (Approved by Finance Committee March 9, 2009) Attachments ENGINEERING SERVICES 26. Motion to authorize Georgia Power Company to proceed with procurement process, underground rough-in and timely installation of parking lot site lighting in the amount of $123,033.00 which includes trenching, underground conduit, wiring, installation of decorative poles and lights for the new Judicial Center. (Approved by Engineering Services Committee March 9, 2009) Attachments 27. Motion to authorize Potts Construction Company to award Bid Package 4, in the amount of $16,181,872.00, which includes Structural Steel, Courtroom Mock-ups, Drywall/Framing/ACT, Window Wash Tie-Backs, Elevators, HVAC, Plumbing, Fire Protection, and Electrical, for the new Judicial Center with a report given by Potts Construction on a periodic basis regarding local business participation in the project. (Approved by Engineering Services Committee March 9, 2009) Attachments 28. Motion to approve $29,626.25 to Eagle Utility for emergency repair work on Doug Barnard Parkway. (Approved by Engineering Services Committee March 9, 2009) Attachments 29. Motion to approve Capital Project Budget (CPB) and Supplemental Agreement Number One for the FERC Dam Safety Performance Monitoring Program in the amount of $624,470.00 to certify the Augusta Levee in accordance with both FEMA (Federal Emergency Management Agency), and the Army Corp of Engineers guidelines. (Approved by Engineering Services Committee March 9, 2009) Attachments 30. Motion to authorize condemnation to acquire a permanent drainage and access easement and a temporary construction easement for the AUD D’Antignac Drainage Improvements Project at the property designated as Tax Map 046-2, Parcel 120-01, 1225 Walton Way. (Approved by Engineering Services Committee March 9, 2009) Attachments 31. Motion to award Design Consultant Services Agreement to WR Toole Engineers, Inc. for the Capital Project Budget in the amount of $500,000 on the East Augusta Street and Drainage Improvements Project to be funded from SPLOST Phase III Urban Recapture Funds for the Engineering Department. (Approved by Engineering Services Committee March 9, 2009) Attachments 32. Motion to approve and accept a Deed of Easement from Norfolk Southern, NS Activity #1108126. (Approved by Engineering Services Committee March 9, 2009) Attachments 33. Motion to approve and accept a Deed of Easement from Norfolk Southern, NS Activity #1108127. (Approved by Engineering Services Committee March 9, 2009) Attachments 34. Motion to approve an Easement Deed from Southern Region Industrial Realty, Inc. (Approved by Engineering Services Committee March 9, 2009) Attachments 35. Motion to approve Capital Project Budget Change Number One and Award Design Consultant Services Agreement to W.K. Dickson and Co., Inc. in the amount of $328,735.00 for the Wilkinson Garden Area Roadway Drainage Improvements Project (CPB# 323-041110-204823525). Funds of $291,180.00 are to be used from the Project Engineering Account, and $37,555.00 from Phase III Recapture to fully fund the Design Phase for the Engineering Department. (Approved by Engineering Services Committee March 9, 2009) Attachments PETITIONS AND COMMUNICATIONS 36. Motion to approve the minutes of the regular meeting of the Commission held on March 3, 2009. Attachments APPOINTMENT(S) 37. Motion to approve the appointment of Mr. Randy Sasser to the Augusta Aviation Commission due to the resignation of Mr. Jim Jatho and Mr. Roy Rearden to the unexpired term of Mr. Sasser on General Aviation Commission representing District 7. Attachments ****END CONSENT AGENDA**** AUGUSTA COMMISSION 3/17/2009 AUGUSTA COMMISSION REGULAR AGENDA 3/17/2009 (Items 38-47) PLANNING 38. Z-09-08 - A request for concurrence with the Augusta-Richmond County Planning Commission to approve with the condition that all items in the agreement signed by the petitioner (Arthur Poe) and George Patty are adhered to; a petition by Arthur Poe requesting a change of zoning from Zone R-1 (One-family Residential) to Zone R- MH (Manufactured Home Residential) affecting property containing 2.8 acres and is part of property known in the present numbering system as 3935 Old Waynesboro Road ( Part of Tax Map 183-0-004-05-0) DISTRICT 8 Attachments 39. Z-09-09 - A request for concurrence with the Augusta-Richmond County Planning Commission to deny a petition by Walton Rehabilitation Health, on behalf of Brent Richards, requesting a change of zoning from Zone R-1A (One-family Residential) to Zone R-3A (Multiple-family Residential) affecting property containing 1.91 acres, more or less, and consists of eight tax parcels. (Tax Parcel 097-4-179-00-0, 097-4-178-00-0, 097-4-198-00-0, 097-4-180-00-0, 097-4-181-00-0, 097-4-183-00-0 and 097-4-184-00-0) DISTRICT 6 Attachments PUBLIC SERVICES 40. Motion to approve a request by Shawn Laws for a Sunday Sales license to be used in connection with The Original Tavern located at 3664 Wheeler Rd. There will be Sunday Sales. District 3. Super District 10. (No recommendation from Public Services Committee March 9, 2009) Attachments 41. New Ownership Application: A. N. 09 - 66: A request by Robert Finiguerra Jr. for an on premise consumption Liquor, Beer & Wine license to be used in connection with The Vue located at 471 Highland Ave. There will be Dance. District 7. Super District 10. (No recommendation from Public Services Committee March 9, 2009) Attachments 42. New Ownership Application: A. N. 09 - 67: A request by Robert H. Finiguerra Jr. for an on premise consumption Liquor, Beer & Wine license to be used in connection with Surrey Tavern located at 469 Highland Ave. There will be Dance. District 7. Super District 10. (No recommendation from the Public Services Committee March 9, 2009) Attachments Upcoming Meetings www.augustaga.gov APPOINTMENT(S) 43. Motion to approve the appointment of W. Stuart Flanagin to the seat held by Eugene Hunt on the Richmond County Board of Health. (Requested by Commissioner Jerry Brigham) Attachments ADMINISTRATOR 44. Motion to receive an report update from the Administrator. Attachments 45. Motion to approve a Resolution for Tax Anticipation Note to be paid through the Local Option Sales Tax (SPLOST) Phase VI . Attachments OTHER BUSINESS 46. Update on the Augusta Canal Cleanup. (Requested by Commissioner Joe Bowles) Attachments LEGAL MEETING A. Pending and Potential Litigation. B. Real Estate. C. Personnel. 47. Motion to authorize execution by the Mayor of the affidavit of compliance with Georgia's Open Meeting Act. Commission Meeting Agenda 3/17/2009 12:00 PM Invocation Department:Clerk of Commission Caption:Reverend Timothy R. Green, Pastor Jenkins Memorial CME Church. Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Item # 1 Commission Meeting Agenda 3/17/2009 12:00 PM Buffalo Soldiers Department: Caption:Buffalo Soldiers. RE: Donation to Augusta Recreation and Parks Department in the amount of $2000.00. Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Item # 2 Commission Meeting Agenda 3/17/2009 12:00 PM Don Grantham Department: Caption:Congratulations! Commissioner Don Grantham for completing all course work required for certificate of recognition from the University of Georgia and the Association County Commissioners. Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Item # 3 Commission Meeting Agenda 3/17/2009 12:00 PM US Army Department: Caption:Colonel Robert A. Prince, USAF, Retired and Command Sergeant Major Olin Dorsey, US Army Retired. (Requested by Commissioner Calvin Holland) Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Item # 4 Attachment number 1 Page 1 of 7 Item # 4 Attachment number 1 Page 2 of 7 Item # 4 Attachment number 1 Page 3 of 7 Item # 4 Attachment number 1 Page 4 of 7 Item # 4 Attachment number 1 Page 5 of 7 Item # 4 Attachment number 1Page 6 of 7 Item # 4 Attachment number 1 Page 7 of 7 Item # 4 Commission Meeting Agenda 3/17/2009 12:00 PM Henry T. Armstrong, III Department: Caption:Mr. Henry T. Armstrong,III., Augusta Partnership Specialist U.S. Census. RE: ARC 2010 Census Complete Count Committee Awareness Campaign. Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Item # 5 Commission Meeting Agenda 3/17/2009 12:00 PM Planning Commission Department:Planning Commission Caption: Z-09-06 – A request for concurrence with the Augusta-Richmond County Planning Commission to approve with the following conditions 1) the use of these properties be limited to a convenience store and for the sale of fireplaces and those uses allowed in a B-1 (Neighborhood Business) zone and 2) the work area of the fireplace business be buffered by a solid board fence; a petition by George Nabor requesting a change of zoning from Zone B-1 (Neighborhood Business) to Zone B-2 (General Business) affecting property containing .49 acres and is known under the present numbering system as 2053 Broad Street. (Tax Map 027-3 Parcels 075 and 075-01) DISTRICT 1 Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Item # 6 Commission Meeting Agenda 3/17/2009 12:00 PM Planning Commission Department:Planning Commission Caption: Z-09-11 - A request for concurrence with the Augusta-Richmond County Planning Commission to approve with the following conditions 1) that the manufactured home be placed a minimum of 100 feet off the right-of-way of Piney Grove Road and 2) that a 100 foot undisturbed natural buffer, except for the driveway, remain between the home and Piney Grove Road; a petition by Gloria Shelton, on behalf of Tiffany Shelton, requesting a change of zoning from Zone R-1B (One-family Residential) to Zone A (Agriculture) affecting property approximately1.53 acres and is know as 1178 Piney Grove Road. (Tax Map 338-0-030-00-0) DISTRICT 8 Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Item # 7 Commission Meeting Agenda 3/17/2009 12:00 PM Planning Commission Department:Planning Commission Caption: FINAL PLAT – Townhomes of Windsor, Phase One – S -786-I - A request for concurrence with the Augusta-Richmond County Planning Commission to approve a petition from H. Lawson Graham & Associates, on behalf of Chris Johnson, requesting final plat approval for Townhomes of Windsor Phase 1. This residential townhome subdivision is located off Windsor Spring Road East of Nordahl Drive and contains 18 lots. Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Item # 8 Commission Meeting Agenda 3/17/2009 12:00 PM Planning Commission Department:Planning Commission Caption: Z-09-08 - A request for concurrence with the Augusta-Richmond County Planning Commission to approve with the condition that all items in the agreement signed by the petitioner (Arthur Poe) and George Patty are adhered to; a petition by Arthur Poe requesting a change of zoning from Zone R-1 (One-family Residential) to Zone R-MH (Manufactured Home Residential) affecting property containing 2.8 acres and is part of property known in the present numbering system as 3935 Old Waynesboro Road ( Part of Tax Map 183-0-004-05-0) DISTRICT 8 Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Item # 9 Commission Meeting Agenda 3/17/2009 12:00 PM Planning Commission Department:Planning Commission Caption: Z-09-09 - A request for concurrence with the Augusta-Richmond County Planning Commission to deny a petition by Walton Rehabilitation Health, on behalf of Brent Richards, requesting a change of zoning from Zone R-1A (One-family Residential) to Zone R-3A (Multiple-family Residential) affecting property containing 1.91 acres, more or less, and consists of eight tax parcels. (Tax Parcel 097-4-179-00-0, 097-4-178-00-0, 097-4-198-00-0, 097-4-180-00-0, 097-4-181-00-0, 097-4-183-00-0 and 097-4-184-00-0) DISTRICT 6 Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Item # 10 Commission Meeting Agenda 3/17/2009 12:00 PM alcohol application Department:License & Inspections Caption:Motion to approve a New Application: A. N. 09 - 69: request by Evelyn E. Pilgrim for an on premise consumption Beer license to be used in connection with Business Between Friends DBA My Friends Place located at 353 Highland Ave. There will be Sunday Sales. District 7. Super District 10. (Approved by Public Services Committee March 9, 2009) Background:This is a new application. Analysis:The applicant meets the requirements of the Augusta Richmond County Alcohol Ordinance. Financial Impact:The applicant will pay a fee of $1815.00 Alternatives: Recommendation:License & Inspections recommends approval. The RCSD recommends approval. Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Law. Administrator. Clerk of Commission Cover Memo Item # 11 Attachment number 1 Page 1 of 2 Item # 11 Attachment number 1 Page 2 of 2 Item # 11 Commission Meeting Agenda 3/17/2009 12:00 PM alcohol application Department:License & Inspections Caption:Motion to approve New Application: A. N. 09 - 70: a request by Korey D. Williams for an on premise consumption Liquor, Beer & Wine license to be used in connection with Who's On First Bar & Grill located at 1524 Gordon Hwy. There will be Dance. District 2. Super District 9. (Approved by Public Services Committee March 9, 2009) Background:This a new application. There was a license here a year ago for a bar called Dirty South. Analysis:The applicant meets the requirements of the Augusta Richmond County Alcohol Ordinance. Financial Impact:The applicant will pay a fee of $4,345.00 Alternatives: Recommendation:License & Inspections recommends approval. The RCSD recommends approval. Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Law. Administrator. Clerk of Commission Cover Memo Item # 12 Attachment number 1 Page 1 of 2 Item # 12 Attachment number 1 Page 2 of 2 Item # 12 Commission Meeting Agenda 3/17/2009 12:00 PM alcohol application Department:License & Inspections Caption:Motion to approve a request by Glen Brinson for a Sunday Sales license to be used in connection with 209 Music Lounge located at #4 8th St. There will be Sunday Sales. District 1. Super district 9. (Approved by Public Services Committee March 9, 2009) Background:The is a new request. Analysis: Financial Impact:The applicant will pay a fee of $5,555.00 Alternatives: Recommendation:License & Inspections has no recommendation. Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Law. Administrator. Clerk of Commission Cover Memo Item # 13 Commission Meeting Agenda 3/17/2009 12:00 PM alcohol application Department:License & Inspections Caption:Motion to approve a request by Shawn Laws for a Sunday Sales license to be used in connection with The Original Tavern located at 3664 Wheeler Rd. There will be Sunday Sales. District 3. Super District 10. (No recommendation from Public Services Committee March 9, 2009) Background:This location had Sunday Sales in the past. The license was voluntarily surrendered for insufficient food sales. Analysis: Financial Impact:The applicant will pay a fee of $5,445.00 Alternatives: Recommendation:License & Inspections has no recommendation. Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Law. Administrator. Clerk of Commission Cover Memo Item # 14 Attachment number 1 Page 1 of 1 Item # 14 Commission Meeting Agenda 3/17/2009 12:00 PM alcohol application Department:License & Inspections Caption:Motion to approve a request by Chris T. Kuneman for a Sunday Sales license to be used in connection with Rack & Grill located at 3801 Mike Padgett Hwy. There will be Sunday Sales. District 8. Super District 10. (Approved by Public Services Committee March 9, 2009) Background:The applicant has a current license. Analysis:The applicant meets the requirements of the Augusta Richmond County Alcohol Ordinance. Financial Impact:The applicant wil pay a fee of $1815.00 Alternatives: Recommendation:License & Inspections recommends approval. Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Law. Administrator. Clerk of Commission Cover Memo Item # 15 Attachment number 1 Page 1 of 2 Item # 15 Attachment number 1 Page 2 of 2 Item # 15 Commission Meeting Agenda 3/17/2009 12:00 PM alcohol application Department:License & Inspections Caption:Motion to approve a request by Jan Scholer for a Special Events License for (5) five days April 7th thru April 11, 2009 for Masters Week to be used in connection with Wild Wing Cafe located 3035 Washington Rd. (In the parking lot) District 7. Super District 10. (Approved by Public Services Committee March 9, 2009) Background:This applicant applies for this license every Masters. Analysis:The applicant meets the requirements of the Augusta Richmond Coutny alcohol Ordinance. Financial Impact:The applicant will pay a fee of $250.00 Alternatives: Recommendation:License & Inspections recommends approval. The RCSD recommends approval. Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Law. Administrator. Clerk of Commission Cover Memo Item # 16 Attachment number 1 Page 1 of 1 Item # 16 Commission Meeting Agenda 3/17/2009 12:00 PM alcohol application Department:License & Inspections Caption:Motion to approve a request by Melissa Ruiz for a Special Events License for (4) four days April 8th thru April 11, 2009 for Masters Week to be used in connection with Mi Rancho 2, Inc. located at 3064 Washington Rd. (In the parking lot). District 7. Super District 10. (Approved by Public Services Committee March 9, 2009) Background:This is a new request. Analysis:The applicant meets the requirements of the Augusta Richmond County Alcohol Ordinance. Financial Impact:The applicant will pay a fee of $200.00. Alternatives: Recommendation:License & Inspections recommends approval. The RCSD recommends approcal. Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 1 Commission Meeting Agenda 3/17/2009 12:00 PM Alcohol Application Department:License & Inspections Caption:New Ownership Application: A. N. 09 - 66: A request by Robert Finiguerra Jr. for an on premise consumption Liquor, Beer & Wine license to be used in connection with The Vue located at 471 Highland Ave. There will be Dance. District 7. Super District 10. (No recommendation from Public Services Committee March 9, 2009) Background:This a new ownership application. Formerly in the name of Paul Davis. Analysis:The applicant meets the requirements of the Augusta Richmond County Alcohol Ordinance. Financial Impact:The applicant will pay a fee of $4,345.00. Alternatives: Recommendation:License & Inspections recommends approval. The RCSD recommends approval. Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Attachment number 1Page 1 of 2 Attachment number 1Page 2 of 2 Commission Meeting Agenda 3/17/2009 12:00 PM Alcohol Application Department:License & Inspections Caption:New Ownership Application: A. N. 09 - 67: A request by Robert H. Finiguerra Jr. for an on premise consumption Liquor, Beer & Wine license to be used in connection with Surrey Tavern located at 469 Highland Ave. There will be Dance. District 7. Super District 10. (No recommendation from the Public Services Committee March 9, 2009) Background:This is a new ownership application. Formerly in the name of Paul Davis. Analysis:The applicant meets the requirements of the Augusta Richmond County Alcohol Ordinance. Financial Impact:The applicant will pay a fee of $4,345.00. Alternatives: Recommendation:License & Inspections recommends approval. The RCSD recommends approval. Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Attachment number 1Page 1 of 2 Attachment number 1Page 2 of 2 Commission Meeting Agenda 3/17/2009 12:00 PM Jamestown Community Center Building Addition Department:Tom F. Beck, Director, Recreation and Parks Department Caption:Motion to approve additional funds not to exceed $50,000 to be used for the completion of a building addition to the Jamestown Community Center. (Approved by Public Services Committee March 9, 2009) Background:In October of 2007, the City of Augusta entered into an agreement with the Sandridge Community Association (SCA) for funding of $130,000 for a capital improvement project at Jamestown Community Center. A building addition of @2,800 sq ft was undertaken by the SCA. However due to a shortfall in funding, the project has been put on hold. Analysis:In an effort to leverage these SPLOST funds with the SCA and their supporters and volunteers, a much needed building expansion began under the leadership of SCA's President, Sammie Sias. To their credit, commitment and long dedicated hours to this project, they only have been able to achieve an 80% completion on this project. In order to have this facility in use by the summer, additional funds will be required with the remaining work on this project to be managed and administered by staff. Financial Impact:The requested amount to finish this project will be a not to exceed amount of $50,000. Alternatives:1. To approve additional funding from SPLOST V Interest Earnings for an amount not to exceed $50,000. 2. Move no action thus leaving this facility unfinished and incomplete. Recommendation:1. To approve. Funds are Available in the Following Accounts:32500000 - 3952110 REVIEWED AND APPROVED BY: Finance. Law. Administrator. Clerk of Commission Cover Memo Commission Meeting Agenda 3/17/2009 12:00 PM AN ORDINANCE TO AMEND THE AUGUSTA, GA CODE TO ADD A DEFINITION FOR THE TERM “MOTORIZED CART” Department:Law Caption:Motion to approve an Ordinance to amend Title Three of the Augusta, Georgia Code to add a definition for the term "Motorized Cart: to Section 3- 5-1, to repeal all ordinances in conflict herewith, to provide an effective date and for other purposes. (Approved by Administrative Services Committee March 9, 2009) Background:Augusta, GA Code Section §3-5-1, in subsection (b) provides 47 definitions of terms applicable to Chapter Five- Motor Vehicles and Traffic. Analysis:The proposed Code amendment will add a definition of “Motorized Cart” which will be reflected as definition (48) of AUGUSTA, GA CODE Section §3-5-1(b) and will read: "(48) Motorized Cart. Every motor vehicle having no less than three wheels and an unladen weight of 1,300 pounds or less and which cannot operate at more than 20 miles per hour." Financial Impact:No financial impact is anticipated. Alternatives:Decline to add a definition of the term "Motorized Cart." Recommendation:Authorize this amendment to the Code to improve the clarity of the restrictions which relate to Motorized Carts in Augusta. Funds are Available in the Following Accounts: N/A. REVIEWED AND APPROVED BY: Finance. Law. Administrator. Clerk of Commission Cover Memo Ordinance No.___________ AN ORDINANCE TO AMEND TITLE THREE OF THE AUGUSTA, GA CODE TO ADD $'(),1,7,21)257+(7(50³02725,=('&$57´72SECTION 3-5-1, TO REPEAL ALL ORDINANCES IN CONFLICT HEREWITH, TO PROVIDE AN EFFECTIVE DATE AND FOR OTHER PURPOSES. WHEREAS, the AUGUSTA, GA CODE does not currently contain a definition of the term ³0RWRUL]HG&DUW´ WHEREAS, it is the desire of the Commission to improve the clarity of Code language regarding the use of certain motorized vehicles in Augusta-Richmond County; THE AUGUSTA-RICHMOND COUNTY COMMISSION hereby ordains as follows: SECTION 1. AUGUSTA, GA CODE Section §3-5-1 as set forth in Ordinance No. 6436, enacted November 19, 2002 and as amended and re-adopted July 10, 2007, is hereby amended by adding DGHILQLWLRQIRUWKHWHUP³0RWRUL]HG&DUW´LQVXEVHFWLRQb), which provides definitions of terms applicable to Chapter Five- Motor Vehicles and Traffic. The newly added definition of ³0RWRUL]HG&DUW´VKDOOEHUHIOHFWHGas definition (48) of AUGUSTA, GA CODE Section §3-5-1(b), DVVHWIRUWKLQ³([KLELWA´KHUHWR SECTION 2. This ordinance shall become effective upon its adoption in accordance with applicable laws. SECTION 3. All ordinances or parts of ordinances in conflict herewith are hereby repealed. Adopted this ___ day of ___________, 2009. ___________________________ David S. Copenhaver As its Mayor Attest: ______________________________ Lena J. Bonner, Clerk of Commission Attachment number 1Page 1 of 4 CERTIFICATION The undersigned Clerk of Commission, Lena J. Bonner, hereby certifies that the foregoing Ordinance was duly adopted by the Augusta-Richmond County Commission on _________________, 2009 and that such Ordinance has not been modified or rescinded as of the date hereof and the undersigned further certifies that attached hereto is a true copy of the Ordinance which was approved and adopted in the foregoing meeting(s). ______________________________ Lena J. Bonner, Clerk of Commission Published in the Augusta Chronicle. Date: ______________________ First Reading: ________________________ Second Reading: ______________________ Attachment number 1Page 2 of 4 ([KLELW³$´ Attachment number 1Page 3 of 4 Sec. 3-5-1. Definitions of words and phrases. (b) Whenever any words and phrases used in this chapter are not defined herein but are defined in the state laws regulating the operation of vehicles, any such definition therein shall be deemed to apply to such words and phrases used herein, except when the context otherwise requires. « ADD (48) Motorized Cart. Every motor vehicle having no less than three wheels and an unladen weight of 1,300 pounds or less and which cannot operate at more than 20 miles per hour. Attachment number 1Page 4 of 4 Commission Meeting Agenda 3/17/2009 12:00 PM Demolition of unsafe structures Department:License & Inspection Caption:Motion to approve an Ordinance providing for the demolition of certain unsafe and uninhabitable structures in the Olde Town Neighborhood: 422 Third Street, (District 1, Super District 9); Harrisburg Neighborhood: 2442 Lawton Street, 1967 Ellis Street, 1809-1811 Fenwick Street, 1711 Fenwick Street, 706 Moore Avenue, 1701-1703 Saint Luke Street, 1851 Wilhelm Lane, (District 1, Super District 9); AND WAIVE 2ND READING. (Approved by Administrative Services Committee March 9, 2009) Background:The approval of this ordinance will provide for the demolition of certain structures that have been determined to be dilapidated beyond repair and a public nuisance. The owners of the above referenced properties have been requested to correct the property maintenance violations. The violations were not corrected. By approving this ordinance the City will have the structures demolished, record a lien against the property in the amount of the costs incurred, and send the property owners a bill for payment that is due within 30 days of receipt. Analysis:Continuing the removal of dilapidated structures will signal to the public that neglected, unsafe and uninhabitable structures will not be allowed and that property owners will be held responsible for their properties. Financial Impact:The average total cost associated with the demolition of each property will be approximately $5,200.00. This includes the title search, asbestos survey, and demolition. Alternatives:Allow the unsafe structures to remain and continue to have a negative impact on the neighborhoods and City. Recommendation:Approval Funds are Available in the Following Accounts: FUNDS ARE AVAILABLE IN THE FOLLOWING ACCOUNT: Account # 101072910 / 5212999 REVIEWED AND APPROVED BY: Finance. Cover Memo Law. Administrator. Clerk of Commission Cover Memo ORDINANCE NO. _____________________ ORDINANCE TO PROCEED WITH DEMOLITION AND REMOVAL OF THE STRUCTURES ON PROPERTY LOCATED AT 422 THIRD STREET, 2442 LAWTON STREET, 1967 ELLIS STREET, 1809-1811 FENWICK STREET, 1711 FENWICK STREET, 706 MOORE AVENUE, 1701-1703 SAINT LUKE STREET, AND 1851 WILHELM LANE. TO REPEAL CONFLICTING ORDINANCES; AND FOR OTHER PURPOSES. BE IT ORDAINED BY THE AUGUSTA-RICHMOND COUNTY COMMISSION AND IT IS HEREBY ORDAINED BY THE AUTHORITY OF SAME AS FOLLOWS: Section I. That the following properties have been identified by the Director of the Augusta – Richmond County License and Inspection Department as unfit for human habitation (or unfit for its current commercial or business use) and the cost of repair, alteration or improvement of said properties exceeds one-half the value of property and that the said Director shall cause the structures located on hereinafter described property to be demolished and removed as ordered by Augusta-Richmond County Magistrate Court; and that said Director shall cause the costs of such removal and demolition for said property be entered upon the lien docket maintained in the office of Clerk of Augusta - Richmond County Commission and said Director shall otherwise proceed to effectuate the purpose of O.C.G.A. SS 41-2-7 through 41-2-17 with respect to said property, to-wit: • 422 THIRD STREET, Augusta – Richmond County, Georgia, identified on Augusta- Richmond County Tax Map 47-4 as Parcel 97. • 2442 LAWTON STREET, Augusta – Richmond County, Georgia, identified on Augusta-Richmond County Tax Map 34-1 as Parcel 118. • 1967 ELLIS STREET, Augusta – Richmond County, Georgia, identified on Augusta-Richmond County Tax Map 35-1 as Parcel 16. • 1809-1811 FENWICK STREET, Augusta – Richmond County, Georgia, identified on Augusta-Richmond County Tax Map 35-4 as Parcel 143. • 1711 FENWICK STREET, Augusta – Richmond County, Georgia, identified on Augusta-Richmond County Tax Map 35-4 as Parcel 180. • 706 MOORE AVENUE, Augusta – Richmond County, Georgia, identified on Augusta-Richmond County Tax Map 35-4 as Parcel 529. • 1701-1703 SAINT LUKE STREET, Augusta – Richmond County, Georgia, identified on Augusta-Richmond County Tax Map 35-2 as Parcel 290. • 1851 WILHELM LANE, Augusta – Richmond County, Georgia, identified on Augusta-Richmond County Tax Map 35-2 as Parcel 562. Attachment number 1Page 1 of 2 Section II. This Ordinance shall become effective upon adoption. Section III. That all Ordinances and parts of Ordinances in conflict herewith are hereby repealed. Duly adopted this _________ day of ____________________, 2009 MAYOR________________________________ ATTEST:_______________________________ CLERK OF COMMISSION Attachment number 1Page 2 of 2 Commission Meeting Agenda 3/17/2009 12:00 PM 2009 New World Maintenance Agreement Department:Information Technology Caption:Motion to approve Standard Software Maintenance Agreement with New World Systems, Inc. for the period covering January 1, 2009 - December 31, 2011. (Approved by Public Safety Committee March 9, 2009) Background:This is an ongoing maintenance agreement for Public Safety-related software which is up for renewal. Analysis:This software maintenance agreement will allow the organization to continue to receive maintenance and support for the New World Systems applications used by various Public Safety Departments to include the Sheriff's Office, E911, and the Fire Department. Financial Impact:The funds are allocated in the 2009 Operating Budget. The costs will be allocated according to the contract for each succeeding year of the agreement unless Augusta purchases additional applications during the contract period. The cost for 2009 is $255,166. Alternatives:N/A Recommendation:Approve Standard Software Maintenance Agreement with New World Systems, Inc. for the period covering January 1, 2009 - December 31, 2011 Funds are Available in the Following Accounts: 101015410.5223110 $184,051 216037110.5223110 $51,682 274034110.5232114 $14,433 REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Commission Meeting Agenda 3/17/2009 12:00 PM Electronic Warrant Interchange Project Department:Information Technology Caption:Motion to approve contract with Palatine Technology Group to provide software, hardware, and services related to Electronic Warrant Interchange. (Approved by Public Safety Committee March 9, 2009 Background:When a person is arrested and booked, the arresting officer must obtain a warrant from the Warrants Office in the Law Enforcement Center (LEC). Typically, this involves the officer physically going to the office and his/her time is spent working on paperwork as opposed to being on patrol. Richmond County Sheriff's Office personnel, as well as IT personnel and Civil & Magistrate Court staff, have viewed multiple demonstrations of "electronic warrant interchange" (EWI) technology. This involves the use of computer networks, computers, and video cameras in order to shorten the warrant process by eliminating the travel component. Images as well as warrants are transmitted electronically so that the warrant can be obtained more quickly and the deputy can return to duty. Analysis:Palatine Technology Group (PTG) is recognized as a leader in providing EWI technology. The company has a strong presence in Georgia. According to Judge Jennings with Richmond County's Civil & Magistrate Court "based upon my conversations with Judges across Georgia, this is the only system with a proven record of reliability, performance, and safety. As Chief Judge of Civil Court, this is the only system I will consider using." Personnel from IT, the Sheriff's Office, and Civil & Magistrate Court have seen the technology and validated that it will save time and effort on the part of law enforcement personnel. Financial Impact:This project will cost approximately $107,975. The cost of the software/hardware/service contract with the vendor is $71,745. Additional hardware (servers, PCs, and printers)and interface costs between this product and New World will increase the final cost to $107,975. This is funded through approved 2008 IT Capital funds. Alternatives:N/A Recommendation:Approve Contract with Palatine Technology Group to provide software, hardware, and services related to Electronic Warrant Interchange Funds are Available in the Following Accounts: 272015410.5424220 2008 carryover Cover Memo REVIEWED AND APPROVED BY: Procurement. Information Technology. Finance. Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Pr o j e c t B u d g e t a n d C o s t s Pr o j e c t El e c t r o n i c W a r r a n t I n t e r c h a n g e I m p l e m e n t a t i o n Ve n d o r Pa l a t i n e T e c h n o l o g y G r o u p ( P T G ) Bu d g e t e d A m o u n t 13 7 , 5 0 0 . 0 0 $ Ac c o u n t N u m b e r s 27 2 0 1 5 4 1 0 . 5 4 2 4 2 2 0 Bu d g e t Y e a r 20 0 8 So f t w a r e a n d I m p l e m e n t a t i o n C o s t s Ve n d o r I n v o i c e s ( a d d C o l u m n s a s N e e d e d ) It e m Co m m e n t s U n i t s Es t i m a t e d U n i t Pr i c e Es t i m a t e d Am o u n t Ac t u a l A m o u n t Ve n d o r / M a n a g e m e n t C o s t s EW I J u s t i c e S u i t e W a r r a n t S e r v e r L i c e n s e F i r s t ye a r ( v e r s i o n 4 . 0 ) PT G - S R V - 1 0 0 0 1 $ 9 , 9 9 5 . 0 0 $ 9 , 9 9 5 . 0 0 $ - EW I S e r v e r S u p p o r t f o r O n e Y e a r , p r o v i d e s au t o m a t i c s o f t w a r e u p g r a d e a t n o c o s t PT G - S U P P O R T 5 1 $ 3 , 5 0 0 . 0 0 $ 3 , 5 0 0 . 0 0 $ - EW I J u s t i c e S u i t e W a r r a n t C l i e n t L i c . (V . 4 . 0 ) i n c l u d i n g S e a r c h W a r r a n t PT G - E W I - C L 1 0 0 8 $ 2 , 4 9 5 . 0 0 $ 1 9 , 9 6 0 . 0 0 $ - EW I J u d g e ' s J u s t i c e S u i t e W a r r a n t C l i e n t L i c . C:\ P r o g r a m F i l e s \ N e e v i a . C o m \ D o c u m e n t C o n v e r t e r \ t e m p \ P D F C o n v e r t . 9 3 9 1 . 1 . E W I P r o j e c t B u d g e t . x l s 3/1 3 / 2 0 0 9 Pa g e 1 o f 5 EW I J u d g e ' s J u s t i c e S u i t e W a r r a n t C l i e n t L i c . (V . 3 ) i n c l u d i n g S e a r c h W a r r a n t { J u d g e ' s re s i d e n c e s ( 2 ) a n d M a g i s t r a t e C o u r t ( 1 ) } F i r s t y e a r Li c e n s e PT G - E W I - C L 2 0 0 4 $ 3 , 2 9 5 . 0 0 $ 1 3 , 1 8 0 . 0 0 $ - In s t a l l a t i o n i n c l u d e s : I n s t a l l a t i o n o f S e r v e r , O S , Ap p l i c a t i o n s o f t w a r e , V i d e o c o n f e r e n c i n g ha r d w a r e a n d s o f t w a r e a n d t e s t i n g o f a b o v e f o r ma x i m u m p e r f o r m a n c e PT G - I M P - 1 0 0 1 $ 4 , 5 0 0 . 0 0 $ 4 , 5 0 0 . 0 0 $ - EW I S e r v i c e C o n t r a c t f o r a b o v e s y s t e m . O n s i t e an d P h o n e s u p p o r t f o r F i r s t Y e a r ( 2 4 hr s / 7 d a y s / 3 6 5 d a y s a y e a r ) - F i r s t y e a r PT G - S U P P O R T 2 12 $ 8 9 5 . 0 0 $ 1 0 , 7 4 0 . 0 0 $ - EW I T r a i n i n g S e s s i o n ( o n e d a y a t $ 1 5 0 0 p e r d a y ) P T G _ T R N 2 $ 1 , 5 0 0 . 0 0 $ 3 , 0 0 0 . 0 0 $ - Po t e n t i a l N e w W o r l d I n t e r f a c e ( P a l a t i n e p o r t i o n ) No t e : N O T c u r r e n t l y s p e c i f i e d a s p a r t o f c o n t r a c t - t h i s w i l l b e ad d e d a f t e r s y s t e m a n d p r o c e s s i s a s s e s s e d . P r i c e i s a n es t i m a t e . 1 $ 7 , 5 0 0 . 0 0 $ 7 , 5 0 0 . 0 0 $ - Ne w W o r l d I n t e r f a c e ( N e w W o r l d p o r t i o n ) No t e : N O T c u r r e n t l y s p e c i f i e d a s p a r t o f c o n t r a c t - t h i s w i l l b e ad d e d a f t e r s y s t e m a n d p r o c e s s i s a s s e s s e d . P r i c e i s a n es t i m a t e . 1 $ 2 0 , 0 0 0 . 0 0 $ 2 0 , 0 0 0 . 0 0 $ - TO T A L $ 9 2 , 3 7 5 . 0 0 $ - $ - $ - $ - Tr a v e l / M e a l s / L o d g i n g ( b i l l e d a s i n c u r r e d ) It e m Co m m e n t s U n i t s Es t i m a t e d U n i t Pr i c e Es t i m a t e d Am o u n t 0 0 0 0 A c t u a l A m o u n t In c l u d e d a s p a r t o f p r o j e c t c o s t , s o t h e r e s h o u l d be n o b i l l i n g s f o r t h i s u n l e s s w e a s k f o r a d d i t i o n a l tr a i n i n g , e t c . 0 - $ $ - $ - TO T A L T R A V E L / M E A L S / L O D G I N G $ - $ - $ - $ - $ - Ha r d w a r e S u p p l i e d B y V e n d o r C:\ P r o g r a m F i l e s \ N e e v i a . C o m \ D o c u m e n t C o n v e r t e r \ t e m p \ P D F C o n v e r t . 9 3 9 1 . 1 . E W I P r o j e c t B u d g e t . x l s 3/1 3 / 2 0 0 9 Pa g e 1 o f 5 Attachment number 2Page 1 of 5 Pr o j e c t B u d g e t a n d C o s t s It e m Pa r t # U n i t s Es t i m a t e d U n i t Pr i c e Es t i m a t e d Am o u n t 0 0 0 0 A c t u a l A m o u n t EW I A c c e s s o r i e s P a c k a g e : i n c l u d e s U S B I I c o l o r ca m e r a w i t h e c h o c a n c e l l i n g m i c r o p h o n e , am p l i f i e d s p e a k e r s , S o f t w a r e C o d e c a n d v i d e o co n f e r e n c i n g s o f t w a r e , S i g n a t u r e P a d a n d so f t w a r e . PT G - A C C - 3 0 0 12 $ 5 5 0 . 0 0 $ 6 , 6 0 0 . 0 0 $ - 0 - $ $ - $ - To t a l H a r d w a r e C o s t $ 6 , 6 0 0 . 0 0 $ - $ - $ - $ - Ha r d w a r e S u p p l i e d B y I T It e m No t e s U n i t s Es t i m a t e d U n i t Pr i c e Es t i m a t e d Am o u n t 0 0 0 0 A c t u a l A m o u n t PC 2 i n b o o k i n g , 1 i n C I D , 1 i n N a r c o t i c s , 1 a t P h i n i z y R d 5 $ 1 , 0 0 0 . 0 0 $ 5 , 0 0 0 . 0 0 $ - Pr i n t e r s 1 i n b o o k i n g . A l l o t h e r s s h o u l d b e n e t w o r k e d t o e x i s t i n g pr i n t e r s 1 1 , 0 0 0 . 0 0 $ $ 1 , 0 0 0 . 0 0 $ - Se r v e r 1 3 , 0 0 0 . 0 0 $ $ 3 , 0 0 0 . 0 0 $ - 0 - $ $ - $ - 0 - $ $ - $ - 0 - $ $ - $ - To t a l H a r d w a r e C o s t $ 9 , 0 0 0 . 0 0 $ - $ - $ - $ - In v o i c e T o t a l s $ - $ - $ - $ - Ov e r a l l P r o j e c t T o t a l s Pr o j e c t e d $ 1 0 7 , 9 7 5 . 0 0 A c t u a l $ - C:\ P r o g r a m F i l e s \ N e e v i a . C o m \ D o c u m e n t C o n v e r t e r \ t e m p \ P D F C o n v e r t . 9 3 9 1 . 1 . E W I P r o j e c t B u d g e t . x l s 3/1 3 / 2 0 0 9 Pa g e 2 o f 5 Ov e r a l l P r o j e c t T o t a l s Pr o j e c t e d $ 1 0 7 , 9 7 5 . 0 0 A c t u a l $ - Ma i n t e n a n c e ( A c c e p t a n c e + 1 5 m o n t h s ) EW I S e r v i c e C o n t r a c t fo r a b o v e s y s t e m . O n s i t e an d P h o n e s u p p o r t f o r F i r s t Y e a r ( 2 4 hr s / 7 d a y s / 3 6 5 d a y s a y e a r ) - F i r s t y e a r PT G - S U P P O R T 2 12 $ 1 , 1 3 5 . 0 0 $ 1 3 , 6 2 0 . 0 0 EW I S e r v e r S u p p o r t f o r O n e Y e a r , p r o v i d e s au t o m a t i c s o f t w a r e u p g r a d e a t n o c o s t PT G - S U P P O R T 5 1 $ 3 , 5 0 0 . 0 0 $ 3 , 5 0 0 . 0 0 Pr o j e c t e d A n n u a l O p e r a t i n g / M a i n t e n a n c e C o s t $1 7 , 1 2 0 . 0 0 Bu d g e t e d A m o u n t 13 7 , 5 0 0 . 0 0 $ Pr o j e c t e d P r o j e c t A m o u n t 10 7 , 9 7 5 . 0 0 $ Pr o j e c t e d B u d g e t S u r p l u s 29 , 5 2 5 . 0 0 $ Am o u n t S p e n t o n P r o f e s s i o n a l S v c s - $ Am o u n t S p e n d o n T r a v e l - $ Am o u n t S p e n t o n H a r d w a r e - $ Am o u n t R e m a i n i n g 13 7 , 5 0 0 . 0 0 $ C:\ P r o g r a m F i l e s \ N e e v i a . C o m \ D o c u m e n t C o n v e r t e r \ t e m p \ P D F C o n v e r t . 9 3 9 1 . 1 . E W I P r o j e c t B u d g e t . x l s 3/1 3 / 2 0 0 9 Pa g e 2 o f 5 Attachment number 2Page 2 of 5 Pr o j e c t B u d g e t a n d C o s t s 90 D a y s f o l l o w i n g A c c e p t a n c e Mo d u l e Li c e n s e s EW I S e r v e r S u p p o r t 1 EW I S e r v i c e C o n t r a c t On s i t e a n d p h o n e s u p p o r t b e g i n n i n g 2 nd y e a r ( 2 4 h r s / 7 d a y s / 3 6 5 d a y s a y e a r ) Re m a i n i n g Am o u n t PO N u m b e r N o t e s $ ( 9 , 9 9 5 . 0 0 ) $ ( 3 , 5 0 0 . 0 0 ) 15 M o n t h s f o l l o w i n g A c c e p t a n c e $ ( 1 9 , 9 6 0 . 0 0 ) 12 To t a l L i c e n s e F e e C:\ P r o g r a m F i l e s \ N e e v i a . C o m \ D o c u m e n t C o n v e r t e r \ t e m p \ P D F C o n v e r t . 9 3 9 1 . 1 . E W I P r o j e c t B u d g e t . x l s 3/1 3 / 2 0 0 9 Pa g e 3 o f 5 $ ( 1 3 , 1 8 0 . 0 0 ) Mo d u l e L i c e n s e s $ ( 4 , 5 0 0 . 0 0 ) EW I S e r v e r S u p p o r t 1 $ ( 1 0 , 7 4 0 . 0 0 ) EW I S e r v i c e C o n t r a c t $ ( 3 , 0 0 0 . 0 0 ) On s i t e a n d p h o n e s u p p o r t b e g i n n i n g 2 nd y e a r ( 2 4 h r s / 7 d a y s / 3 6 5 d a y s a y e a r ) $ ( 7 , 5 0 0 . 0 0 ) $ ( 2 0 , 0 0 0 . 0 0 ) $ ( 9 2 , 3 7 5 . 0 0 ) Re m a i n i n g Am o u n t PO N u m b e r N o t e s $ - $ - To t a l L i c e n s e F e e 12 C:\ P r o g r a m F i l e s \ N e e v i a . C o m \ D o c u m e n t C o n v e r t e r \ t e m p \ P D F C o n v e r t . 9 3 9 1 . 1 . E W I P r o j e c t B u d g e t . x l s 3/1 3 / 2 0 0 9 Pa g e 3 o f 5 Attachment number 2Page 3 of 5 Pr o j e c t B u d g e t a n d C o s t s Re m a i n i n g Am o u n t PO N u m b e r N o t e s $ ( 6 , 6 0 0 . 0 0 ) $ - $ ( 6 , 6 0 0 . 0 0 ) Re m a i n i n g Am o u n t PO N u m b e r N o t e s $ ( 5 , 0 0 0 . 0 0 ) $ ( 1 , 0 0 0 . 0 0 ) $ ( 3 , 0 0 0 . 0 0 ) $ - $ - $ - $ ( 9 , 0 0 0 . 0 0 ) $ ( 1 0 7 , 9 7 5 . 0 0 ) $ 1 3 7 , 5 0 0 . 0 0 C:\ P r o g r a m F i l e s \ N e e v i a . C o m \ D o c u m e n t C o n v e r t e r \ t e m p \ P D F C o n v e r t . 9 3 9 1 . 1 . E W I P r o j e c t B u d g e t . x l s 3/1 3 / 2 0 0 9 Pa g e 4 o f 5 $ 1 3 7 , 5 0 0 . 0 0 C:\ P r o g r a m F i l e s \ N e e v i a . C o m \ D o c u m e n t C o n v e r t e r \ t e m p \ P D F C o n v e r t . 9 3 9 1 . 1 . E W I P r o j e c t B u d g e t . x l s 3/1 3 / 2 0 0 9 Pa g e 4 o f 5 Attachment number 2Page 4 of 5 Pr o j e c t B u d g e t a n d C o s t s Co s t P e r L i c e n s e To t a l F e e $3 , 5 0 0 $3 , 5 0 0 $1 4 , 2 4 0 $8 9 5 $ 1 0 , 7 4 0 C:\ P r o g r a m F i l e s \ N e e v i a . C o m \ D o c u m e n t C o n v e r t e r \ t e m p \ P D F C o n v e r t . 9 3 9 1 . 1 . E W I P r o j e c t B u d g e t . x l s 3/1 3 / 2 0 0 9 Pa g e 5 o f 5 Co s t P e r L i c e n s e T o t a l F e e $3 , 5 0 0 $ 3 , 5 0 0 $1 7 , 1 2 0 $1 , 1 3 5 $ 1 3 , 6 2 0 C:\ P r o g r a m F i l e s \ N e e v i a . C o m \ D o c u m e n t C o n v e r t e r \ t e m p \ P D F C o n v e r t . 9 3 9 1 . 1 . E W I P r o j e c t B u d g e t . x l s 3/1 3 / 2 0 0 9 Pa g e 5 o f 5 Attachment number 2Page 5 of 5 Attachment number 3Page 1 of 1 Attachment number 3Page 1 of 1 Attachment number 3Page 1 of 1 Attachment number 3Page 1 of 1 Commission Meeting Agenda 3/17/2009 12:00 PM New World System Redundancy for Corrections and Records Department:Information Technology Caption:Motion to approve the acquisition of software and services related to the redundancy of the Sheriff's Office Jail and Records Hardware and Software. (Approved by Public Safety Committee March 9, 2009) Background:IT currently maintains an IBM AS400 which houses the Jail/Corrections Software as well as the Sheriff's Office Records Management System (RMS). At present, when this system is down for maintenance, Corrections and Records do not have access to their software. The AS400 is an exceptionally dependable hardware platform, but maintenance is a requirement in order to keep the operating system and software functioning at an optimal level. Analysis:In order to ensure that public safety is not compromised in any way, New World offers "redundancy" for their system. This means that when the AS400 is unavailable, the software functions will be transferred to another AS400 so that operations are restored within minutes with no loss of data or functionality. This is being procured as an additional license to our existing solution from New World. Financial Impact:This solution is being funded using $27,000 from IT's 2008 Capital Budget. Alternatives:N/A Recommendation:Approve the acquisition of software and services related to the redundancy of the Sheriff's Office Jail and Records Hardware and Software Funds are Available in the Following Accounts:272015410.5424120 (carryover from 2008) REVIEWED AND APPROVED BY: Procurement. Information Technology. Finance. Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Commission Meeting Agenda 3/17/2009 12:00 PM 2008 City property tax abatement Department:Attorney Caption:Motion to approve abatement of 2008 County Ad Valorem Taxes on properties acquired by Augusta-Richmond County. (Approved by Finance Committee March 9, 2009) Background:In connection with property acquisitions in 2008, the County purchased all or a portion of the following tract items of land and a request is being made that the County Ad Valorem Taxes be abated during the time the property was owned by Augusta: Alexander Drive Project, GDOT Project No. STP- 0001-00(794), ARC Project No. Project 323-04-296823215 008-3-059-00-0 (1009 Alexander Drive) Bobby Scarboro 013-1-003-00-0 (1044 Alexander Drive) Joe W. Hamilton 013-1-008-00-0 (1054 Alexander Drive) Wayne Schultz 013-3-001-00-0 (1060 Alexander Drive) Doris Gaines Hughes 013- 3-002-00-0 (1062 Alexander Drive) Events Worldwide 013-3-005-00-0 (1076 Alexander Drive) Mildred Timmerman 013-3-007-00-0 (1084 Alexander Drive) C. W. Edwards, Jr. 013-3-008-00-0 (1086 Alexander Drive) C. W. Edwards, Jr. 013-3-009-00-0 (1088 Alexander Drive) Charles Robertson & Jesse E. Johnson, III. 013-3-011-02-0 (1098 Alexander Drive) Raymond Rufo Living Trust 013-1-245-00-0 (2801 Brickrun Way) The J. W. Greenway Co. 013-1-248-00-0 (2807 Brickrun Way) Gregory and Susan Rudy 013-1-253-00-0 (2817 Brickrun Way) Zachary N. Mead 013-1-254- 00-0 (2819 Brickrun Way) Norman C. Skalicky 013-1-256-00-0 (2823 Brickrun Way) Shelley A. Davis 013-1-249-00-0 (2809 Brickrun Way) Elizabeth Carol Maile-Hill 013-1-250-00-0 (2811 Brickrun Way) Patel Nilankumar 013-1-106-00-0 (2501 Carriage Creek) Curtis E. Peters Judicial Center Project 046-2-148-00-0 913 (913 Talcott Street) Sarah Bell Coleman S.R. 4/15th. St. at CR2207 (Central Avenue Project) 045-4-153- 01-0 (1335 Fifteenth St.) Analysis:See Background. Financial Impact:N/A. Alternatives:None practical. Recommendation:Approve the motion Funds are Available in the Following Accounts: N/A Cover Memo REVIEWED AND APPROVED BY: Law. Administrator. Clerk of Commission Cover Memo Commission Meeting Agenda 3/17/2009 12:00 PM 2009 DA/Marshal Replacement Vehicles Department:Finance Department, Fleet Management Division Caption:Motion to approve the replacement of 4 pursuit type vehicles (Impalas) for the Marshal's Office and one vehicle (Impala) for the District Attorney's Office for 2009 from Capital Outlay funds. (Approved by Finance Committee March 9, 2009) Background:Consistent with the provisions of the Fleet Replacement Policy approved in April 2004, 12 vehicles of the Marshal’s Office and 2 vehicles from the District Attorney’s Office were evaluated for replacement. Of the 12 vehicles of the Marshal’s Office that were evaluated 6 vehicles met the replacement criteria. Of the two vehicles of the District Attorney’s Office, one met the replacement criteria. The Administrator has established a replacement limit based on the availability of the Capital Outlay. Four vehicles are recommended for replacement for the Marshal’s Office and one vehicle for the District Attorney’s Office, the evaluation sheets are attached for Commission review. Analysis:Fleet Management submitted a request for bids through the Procurement Department utilizing the Demand Star electronic bid system which offers nationwide bid coverage. Only one bid was received by the Procurement Department as follows for Bid Item 06-196A (bid was published twice): Gordon Chevrolet, Marshal’s package = $22,910, District Attorney package = $20,259.00 each. Financial Impact:The cost of the Marshal’s vehicles will total $91,640.00 and will be purchased using the GMA lease program. An annual obligation of $30,547 will be incurred over a three year period. The District Attorney’s vehicle will be purchased using 2009 Capital outlay for $20,259.00. Alternatives:1. Approve the recommendation as stated. 2. Approve the recommendation in part 3. Disapprove the recommendation.. Recommendation:Approve the purchase of 4 vehicles for the Marshal’s Office using the GMA Lease program and the purchase of 1 vehicle for the District Attorney’s Office. Funds are Available in the Following Accounts: 631-00-0000-11-19114 (GMA Lease Program-Marshal), 272-00- 6440/54.22110 Capital Outlay for DA purchase. Cover Memo REVIEWED AND APPROVED BY: Finance. Procurement. Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 5 Attachment number 1Page 2 of 5 Attachment number 1Page 3 of 5 Attachment number 1Page 4 of 5 Attachment number 1Page 5 of 5 Bid 08-196A Gordon Marshal Chevrolet Delivery 60 Days 5.01 Bid Price $18,938.00 5.01 $18,938.00 6.00 Optional Items 6.01 Power Driver's Seat 0.00 6.01 0.00 6.02 Rubber Flooring 72.00 6.03 Floor Mats 50.00 7.00 Emergency Equipment 7.01 Dual Front Mirror LED 290.00 7.02 Dual Rear Ceiling LED 305.00 7.03 Top Light Bar 1,775.00 7.03 1,775.00 7.04 Able 2 05.6000 Switch Box 105.00 7.04 105.00 7.05 Whe - 295SL 100 Siren 250.00 7.05 250.00 7.06 Whe- SA315P Speaker 195.00 7.06 195.00 7.07 Whe-SABK21 Speaker Bracket 20.00 7.07 20.00 7.08 Head/Tail light Flasher Kit 110.00 7.08 110.00 7.09 Jotto Desk 345.00 7.09 345.00 7.10 Setina #10S Partition 570.00 7.10 570.00 7.11 Motorla Battery Charger 350.00 7.11 350.00 7.12 Three Plug Outlet 47.00 7.12 47.00 7.13 Alpha12R Siren Controller 220.00 7.14 Whe-SA315P in-Grille Speaker 220.00 7.15 Whe-SAK21 Speaker Mt Kit 20.00 7.16 Talon Rocker Switches (2)14.00 7.17 Whe - Flat Lighter LED Light 140.00 7.18 #35 Window Film 160.00 7.18 160.00 7.19 Fire Extinguisher 45.00 7.19 45.00 Total $22,910.00 4 $91,640 $30,547 Number of Units Total Cost GMA Annual Lease Obligation ALL DEPARTMENTS-2009 IMPALA 9C3 POLICE AUTOMOBILE BID OPENING DECEMBER 12, 2008 @ 11:00 Attachment number 2Page 1 of 1 Bid 08-196A Gordon District Chevrolet Attorney Delivery 60 Days 5.01 Bid Price $18,938.00 5.01 $18,938.00 6.00 Optional Items 6.01 Power Driver's Seat 0.00 6.01 0.00 6.02 Rubber Flooring 72.00 6.03 Floor Mats 50.00 7.00 Emergency Equipment 7.01 Dual Front Mirror LED 290.00 7.01 290.00 7.02 Dual Rear Ceiling LED 305.00 7.02 305.00 7.03 Top Light Bar 1,775.00 7.04 Able 2 05.6000 Switch Box 105.00 7.05 Whe - 295SL 100 Siren 250.00 7.06 Whe- SA315P Speaker 195.00 7.07 Whe-SABK21 Speaker Bracket 20.00 7.08 Head/Tail light Flasher Kit 110.00 7.09 Jotto Desk 345.00 7.10 Setina #10S Partition 570.00 7.11 Motorla Battery Charger 350.00 7.12 Three Plug Outlet 47.00 7.12 47.00 7.13 Alpha12R Siren Controller 220.00 7.13 220.00 7.14 Whe-SA315P in-Grille Speaker 220.00 7.14 220.00 7.15 Whe-SAK21 Speaker Mt Kit 20.00 7.15 20.00 7.16 Talon Rocker Switches (2)14.00 7.16 14.00 7.17 Whe - Flat Lighter LED Light 140.00 7.18 #35 Window Film 160.00 7.18 160.00 7.19 Fire Extinguisher 45.00 7.19 45.00 Total $20,259.00 1 $20,259.00 $0GMA Annual Obligation ALL DEPARTMENTS-2009 IMPALA 9C3 POLICE AUTOMOBILE BID OPENING DECEMBER 12, 2008 @ 11:00 Number of Units Total Cost Attachment number 3Page 1 of 1 Invitation to Re-Bid Sealed re-bids will be received at this office until Tuesday, December 16, 2008 at 11:00 A.M. Re-Bid Item #08-196A 2009 – Police Impala for Fleet Department RE-Bids’ will be received by Augusta, GA Commission hereinafter referred to as the OWNER at the offices of: Geri A. Sams Procurement Department 530 Greene Street - Room 605 Augusta, Georgia 30901 706-821-2422 RE-BID documents may be obtained at the office of Augusta, GA Procurement Department, 530 Greene Street – Room 605, Augusta, GA 30901. Documents may be examined during regular business hours at the offices of Augusta, GA Procurement Department. All questions must be submitted in writing to the office of the Procurement Department by Fax at 706-821-2811 or by mail. No re-bid will be accepted by fax, all must be received by mail or hand delivered. The local bidder preference program is applicable to this project. To be approved as a local bidder and receive bid preference on an eligible local project, this certificate and a copy of your local business license must be submitted with your bonafide bid package. No RE-BID may be withdrawn for a period of 90 days after time has been called on the date of opening. Bidders will please note that the number of copies requested; all supporting documents including financial statements and references and such other attachments that may be required by the bid invitation are material conditions of the re-bid. Any package found incomplete or submitted late shall be rejected by the Procurement Office. Any bidder allegedly contending that he/she has been improperly disqualified from bidding due to an incomplete bid submission shall have the right to appeal to the appropriate committee of the Augusta commission. Please mark RE-BID number on the outside of the envelope. Bidders are cautioned that sequestration of RE-BID documents through any source other than the office of the Procurement Department is not advisable. Acquisition of RE-BID documents from unauthorized sources placed the bidder at the risk of receiving incomplete or inaccurate information upon which to base his qualifications. GERI A. SAMS, Procurement Director Publish: cc: Tameka Allen Interim Deputy Administrator Ron Crowden Fleet Management Attachment number 4Page 1 of 1 Vendors Gordon Chevrolet 2031 Gordon Highway Augusta, GA 30909 Legacy Ford, Inc. 413 Industrial Boulevard McDonough, GA 30253 Bobby Jones Ford P.O. Box 15398 Augusta, GA 30919 5.00 Vehicle/Options Required 5.01 $18,938.00 6.00 Outfiter's Specialty Items 6.01 $0.00 6.02 $72.00 6.03 $50.00 7.00 Alert Warning Systems 7.01 $290.00 7.02 $305.00 7.03 $1,775.00 7.04 $105.00 7.05 $250.00 7.06 $195.00 7.07 $20.00 7.08 $110.00 7.09 $345.00 7.10 $570.00 7.11 $350.00 7.12 $47.00 7.13 $220.00 7.14 $220.00 7.15 $20.00 7.16 $14.00 7.17 $140.00 7.18 $160.00 7.19 $45.00 Approximate Delivery Time 60 days ARO Re-Bid #08-196A 2009 - Police Impala for The City of Augusta - Fleet Department Re-Bid Opening Date: Tuesday, December 16, 2008 at 11:00 a.m. Attachment number 5Page 1 of 1 Attachment number 6Page 1 of 1 Gordon Chevrolet 2031 Gordon Highway Augusta, GA 30909 Attn: Jesse Hawes Re-bid Item #08-196A 2009 Police Impala Fleet Department Bid Due: Tues, 12/16/08 @ 11: a.m. Ron Crowden Fleet Department Tameka Allen Interim Deputy Administrator Yvonne Gentry DBE Coordinator Bid Item #08-196 2009 Police Impala Truck For Fleet Department Bid Due: Fri 11/14/08 @ 11:00 a.m. Attachment number 7Page 1 of 1 Commission Meeting Agenda 3/17/2009 12:00 PM 2009 Solid Waste Light Vehicles Department:Finance Department, Fleet Management Division Caption:Motion to approve the replacement of three light pickup trucks for the Solid Waste Department. (Approved by Finance Committee March 9, 2009) Background:The Director of the Solid Waste Department is requesting the replacement of three light pickup trucks for code enforcement officers assigned to the Solid Waste Department. Each truck has been evaluated and exceeds the replacement criteria approved by the Augusta Commission in April 2004. All three trucks are 11 years old, have excessive miles and are recommended for replacement. Evaluation sheets are provided as attachments for Commission review. Analysis:Fleet Management submitted a request for bids through the Procurement Department utilizing the Demand Star electronic bid system which offers nationwide bid coverage. The Procurement Department received quotes back from three venders with only one being compliant (Bid 08-188). A review of bids received shows the following results: Bobby Jones Ford = $ 19,802.00 each; Legacy Ford as noncompliant; and, Gordon Chevrolet as non compliant. Financial Impact:The vehicles will be purchased for a total of $ 59,406.00. Funding for the procurement of this equipment will be provided by the Solid Waste Departments capital outlay. Alternatives:1. Approve the award to the lowest and only compliant bidder, Bobby Jones Ford, Augusta Georgia 2.Do not approve the request. Recommendation:Approve the acquisition of three Ford Rangers from Bobby Jones Ford (lowest Bid offer -08-188) for $ 19,802.00 each for the Solid Waste Department. Funds are Available in the Following Accounts: 542-04-4110/54.22210 REVIEWED AND APPROVED BY: Finance. Cover Memo Procurement. Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 3 Attachment number 1Page 2 of 3 Attachment number 1Page 3 of 3 BID 08-188 Bobby Jones Legacy Gordon Required Ford Ford Chevrolet Items Year 2009 NON NON Brand Ford COMPLIANTCOMPLIANT Model Ranger Delivery Date 90 Days 5.02 Model -EC-4x4 (6Cyl)$18,558.00 $0.00 $0.00 5.03 $18,558.00 6 OUTFITTER'S SPECIALTY ITEMS 6.01 Fire Extinguisher 40 0 0 6.01 40 6.02 Three Plug Outlet Receptacle 45 0 0 6.02 45 6.03 Bed Liner 275 0 0 6.03 275 6.04 ToolBox 245 0 0 6.05 Class III Trailer Hitch 190 0 0 6.05 190 6.06 Trailer Wiring 30 0 0 6.06 30 6.07 2" Trailer Ball 12 0 0 6.07 12 6.08 Window Tint 90 0 0 6.08 90 6.09 Safety Cone Holder 40 0 0 6.1 Safety Cones 105 0 0 6.1 105 7 ALERT WARNING SYSTEMS 7.01 Backup Alarm 50 0 0 7.01 50 7.03 Cab Mount LED Flashiong Light 407 0 0 7.02 407 TOTAL 19,802.00 FOR ALL DEPARTMENTS-COMPACT PICKUP TRUCK-BID OPENING NOVEMBER 14 @ 11:00 Attachment number 2Page 1 of 1 Invitation To Bid Sealed bids will be received at this office until 11:00 a.m. Friday, November 14, 2008 Bid Item #08-188 2009 – Compact Pickup Truck for Fleet Department Bid Item #08-189 2009 – 6000 GVW Series Pickup Truck for Fleet Department Bid Item #08-190 2009 – 8500 GVW Series Pickup Truck for Fleet Department Bid Item #08-196 2009 – Police Impala for Fleet Department BID’s will be received by Augusta, GA Commission hereinafter referred to as the OWNER at the offices of: Geri A. Sams Procurement Department 530 Greene Street - Room 605 Augusta, Georgia 30901 706-821-2422 BID documents may be obtained at the office of Augusta, GA Procurement Department, 530 Greene Street – Room 605, Augusta, GA 30901. Documents may be examined during regular business hours at the offices of Augusta, GA Procurement Department. All questions must be submitted in writing to the office of the Procurement Department by Fax at 706-821-2811 or by mail. No bid will be accepted by fax, all must be received by mail or hand delivered. The local bidder preference program is applicable to this project. To be approved as a local bidder and receive bid preference on an eligible local project, the certification statement as a local bidder and all supporting documents must be submitted to the Procurement Department with your bonafide bid package. No BID may be withdrawn for a period of 90 days after time has been called on the date of opening. Bidders will please note that the number of copies requested; all supporting documents including financial statements and references and such other attachments that may be required by the bid invitation are material conditions of the bid. Any package found incomplete or submitted late shall be rejected by the Procurement Office. Any bidder allegedly contending that he/she has been improperly disqualified from bidding due to an incomplete bid submission shall have the right to appeal to the appropriate committee of the Augusta commission. Please mark BID number on the outside of the envelope. Bidders are cautioned that sequestration of BID documents through any source other than the office of the Procurement Department is not advisable. Acquisition of BID documents from unauthorized sources placed the bidder at the risk of receiving incomplete or inaccurate information upon which to base his qualifications. GERI A. SAMS, Procurement Director Publish: Augusta Chronicle October 16, 23, 30, November 6, 2008 Metro Courier October 22, 2008 cc: Tameka Allen Interim Deputy Administrator Ron Crowden Fleet Management Attachment number 3Page 1 of 1 Vendors Bobby Jones Ford P.O. Box 15398 Augusta, GA 30919 Legacy Ford, Inc. 413 Industrial Boulevard McDonough, GA 30253 Gordon Chevrolet 2031 Gordon Highway Augusta, GA 30909 5.00 Vehicle/Options Required 5.01 15,004.00$ 5.02 16,044.00$ 5.03 $ 18,558.00 6.00 Outfiter's Specialty Items 6.01 $ 40.00 6.02 $ 45.00 6.03 $ 275.00 6.04 245.00$ 6.05 $ 190.00 6.06 $ 30.00 6.07 $ 12.00 6.08 $ 90.00 6.09 40.00$ 6.10 105.00$ 7.00 Alert Warning Systems 7.01 50.00$ 7.02 407.00$ Approximate Delivery Time 90 - 120 Days from receipt of P.O. Bid #08-188 2009 - Compact Pickup Truck for The City of Augusta - Fleet Department Bid Opening Date: Friday, November 14, 2008 at 11:00 a.m. Non-Compliant Contractors Affidavit (Notary); Sub- Contractors Affidavit; LSB Forms Non-Compliant Sub-Contractors Affidavit (Incomplete) Attachment number 4Page 1 of 1 Attachment number 5Page 1 of 1 Attachment number 6Page 1 of 3 Attachment number 6Page 2 of 3 Attachment number 6Page 3 of 3 Commission Meeting Agenda 3/17/2009 12:00 PM 2009 Utilities - Administration Engineering Light Vehicles Department:Finance Department, Fleet Management Caption:Motion to approve the replacement of 4 full size pickup trucks and 1 new sports utility vehicle for the Utilities Department-Administration & Engineering Division. (Approved by Finance Committee March 9, 2009) Background:The Utilities Department – Administration is requesting the replacement of four full size pickup trucks for their inspectors, asset numbers 984146, 994482, F00142, and 994481, and one new sports utility vehicle for Engineering transportation. The pickup trucks have been evaluated and exceed the replacement criteria approved by the Augusta Commission in April 2004. The pickups have extreme idle time, excessive miles, and are recommended for replacement. Evaluation sheets are provided as attachments for Commission review. The SUV will be a new purchase and will be used to support the travel of 5 engineers of the Administration/Engineering Division. There is currently only one vehicle for their use. Analysis:Fleet Management submitted a request for bids through the Procurement Department utilizing the Demand Star electronic bid system which offers nationwide bid coverage. For the full size pickup trucks, Bid 08-189, the Procurement Department received quotes back from three venders with only one being compliant. Review of bids received show the following results: Bobby Jones Ford = $ 23,195 each; Legacy Ford as noncompliant; and, Gordon Chevrolet as non compliant. For the sports utility vehicle, Bid 08- 199, three bids were received as follows: Bobby Jones = $25,602.00; and Gordon Chevrolet retracted their bid, and Terry Cullen Chevrolet’s bid discarded because bidded vehicle is no longer in production. Financial Impact:The vehicles will be purchased for a total of $ 118,382.00. Funding for the procurement of this equipment will be provided by the Utilities Department capital outlay. Alternatives:1. Approve the award to the lowest and only compliant bidder, Bobby Jones Ford, Augusta Georgia 2. Do not approve the request. Recommendation: Funds are Available in the Following Accounts: 506-04-3110/54.22210 (Utilities-Administration & Engineering-Capital Outlay) Cover Memo REVIEWED AND APPROVED BY: Finance. Procurement. Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 4 Attachment number 1Page 2 of 4 Attachment number 1Page 3 of 4 Attachment number 1Page 4 of 4 2008 6,000 GVW PICKUP TRUCKS BID 08-189 Bobby Jones Legacy Gordon Required Ford Ford Chevrolet Items Year 2009 NON NON Brand Ford COMPLIANT COMPLIANT Model F150 BID BID Delivery Date 120 Days 5.01 Model -6,000-RC-4x2 (4.5)$14,876.00 $0.00 $0.00 5.02 Model -6,000-EC-4x2 (4.5)$18,606.00 $0.00 $0.00 5.03 Model - 6,000-EC-4x4 (4.5)$21,367.00 $0.00 $0.00 5.03 $21,367.00 5.04 Model - 6,000-RC-4x2 (5.0)$16,349.00 $0.00 $0.00 5.05 Model - 6,000-EC-4x2 (5.0)$19,835.00 $0.00 $0.00 5.06 Model - 6,000-EC-4x4 (5.0)$22,475.00 $0.00 $0.00 5.07 Speed Control 187.00 0.00 0.00 5.08 Tilt steering Wheel 0.00 0.00 0.00 5.09 HD Cooling Package 291.00 0.00 0.00 5.10 HD Electrical Package 0.00 0.00 0.00 5.11 HD Suspension Package 2,752.00 0.00 0.00 5.12 Skid Plate Package 4x4 133.00 0.00 0.00 5.12 133.00 5.13 Minimum 8 Foot Bed 271.00 0.00 0.00 5.14 Trailer Tow Package 291.00 0.00 0.00 5.14 291.00 6.00 OUTFITTER'S SPECIALTY ITEMS 6.01 Fire Extinguisher 40.00 0.00 0.00 6.01 40.00 6.02 Three Plug Outlet Receptacle 45.00 0.00 0.00 6.03 Bed Liner 275.00 0.00 0.00 6.03 275.00 6.04 ToolBox 232.00 0.00 0.00 6.04 232.00 6.05 Class III Trailer Hitch 175.00 0.00 0.00 6.05 175.00 6.06 Trailer Wiring 25.00 0.00 0.00 6.06 25.00 6.07 2" Trailer Ball 10.00 0.00 0.00 6.08 Window Tint-RC 85.00 0.00 0.00 6.09 Window Tint-EC 95.00 0.00 0.00 6.09 95.00 6.10 Safety Cone Holder 40.00 0.00 0.00 6.11 Safety Cones 105.00 0.00 0.00 6.11 105.00 7.00 ALERT WARNING SYSTEMS 7.01 Backup Alarm 50.00 0.00 0.00 7.01 50.00 7.02 Magnetic Cab LED Light 320.00 0.00 0.00 7.03 Cab Mount LED flashing Light 407.00 0.00 0.00 7.03 407.00 NON-COMPLIANTNON-COMPLIANT $23,195.00 FOR ALL DEPARTMENTS-6,000 GVW TRUCKS-BID OPENING NOVEMBER 14 @ 11:00 Attachment number 2Page 1 of 1 113" WHEELBASE SPORTS UTILITY VEHICLE BID 08-199 Bobby Jones Gordon Cullen Required Ford Chevrolet Chevrolet Items Year 2009 2009 2009 Brand Ford Chevrolet Chevrolet Mnodel Explorer Trailblazer Trailblazer Delivery Date 120 Days 60 Days 100 Days Discontinued Discontinued 5.01 Model - 4x2 - 4.0L (6 Cyl)Production Production Price $22,371.00 $21,590.00 $22,490.00 5.02 Model --4x4 - 4.0L (6 Cyl) Price $24,863.00 $23,662.00 $24,690.00 5.02 $24,863.00 5.03 Model - 4x4 - 4.5L (8 Cyl) Price $26,504.00 No Bid $32,190.00 5.04 Trailer Towing Package 234.00 0.00 0.00 5.04 234.00 5.05 Rubber flooring Package N/A N/A N/A 6.00 OUTFITTER'S SPECIALTY ITEMS 6.01 Fire Extinguisher 40.00 45.00 75.00 6.01 40.00 6.02 Three Plug Outlet Receptacle 45.00 47.00 50.00 6.02 45.00 6.03 Portable Spot Light 50.00 60.00 160.00 6.03 50.00 6.04 Class III Trailer Hitch 210.00 25.00 0.00 6.05 Trailer Wiring 75.00 0.00 0.00 7.00 ALERT WARNING SYSTEMS 7.01 Top Light Bar-LL288000 1,720.00 1,800.00 2,100.00 7.02 Six Control Power W/Console 95.00 110.00 180.00 7.03 Corner Lighting 307.00 307.00 340.00 7.04 Siren/Speaker 420.00 490.00 350.00 7.05 Six outlet 90 watt Power Supply 115.00 150.00 210.00 7.06 Dual Dash LED Light 260.00 300.00 340.00 7.07 Dual LED Rear Deck Light 260.00 300.00 340.00 7.08 Pro Copper Console 355.00 No Bid 360.00 7.09 Talon Rocker Switches-2 0.00 14.00 90.00 7.10 Backup Alarm 50.00 75.00 90.00 7.10 50.00 7.11 Magnetic LED Cab Light 320.00 335.00 410.00 7.11 320.00 7.12 LED Cab Mount Flashing Light 407.00 469.00 460.00 Discontinued Discontinued Model Model TOTAL $25,602.00 FOR ALL DEPARTMENTS-113" WHEELBASE SUV - BID OPENING OCTOBER 19 @ 11:00 Attachment number 3Page 1 of 1 Invitation To Bid Sealed bids will be received at this office until 11:00 a.m. Friday, November 14, 2008 Bid Item #08-188 2009 – Compact Pickup Truck for Fleet Department Bid Item #08-189 2009 – 6000 GVW Series Pickup Truck for Fleet Department Bid Item #08-190 2009 – 8500 GVW Series Pickup Truck for Fleet Department Bid Item #08-196 2009 – Police Impala for Fleet Department BID’s will be received by Augusta, GA Commission hereinafter referred to as the OWNER at the offices of: Geri A. Sams Procurement Department 530 Greene Street - Room 605 Augusta, Georgia 30901 706-821-2422 BID documents may be obtained at the office of Augusta, GA Procurement Department, 530 Greene Street – Room 605, Augusta, GA 30901. Documents may be examined during regular business hours at the offices of Augusta, GA Procurement Department. All questions must be submitted in writing to the office of the Procurement Department by Fax at 706-821-2811 or by mail. No bid will be accepted by fax, all must be received by mail or hand delivered. The local bidder preference program is applicable to this project. To be approved as a local bidder and receive bid preference on an eligible local project, the certification statement as a local bidder and all supporting documents must be submitted to the Procurement Department with your bonafide bid package. No BID may be withdrawn for a period of 90 days after time has been called on the date of opening. Bidders will please note that the number of copies requested; all supporting documents including financial statements and references and such other attachments that may be required by the bid invitation are material conditions of the bid. Any package found incomplete or submitted late shall be rejected by the Procurement Office. Any bidder allegedly contending that he/she has been improperly disqualified from bidding due to an incomplete bid submission shall have the right to appeal to the appropriate committee of the Augusta commission. Please mark BID number on the outside of the envelope. Bidders are cautioned that sequestration of BID documents through any source other than the office of the Procurement Department is not advisable. Acquisition of BID documents from unauthorized sources placed the bidder at the risk of receiving incomplete or inaccurate information upon which to base his qualifications. GERI A. SAMS, Procurement Director Publish: Augusta Chronicle October 16, 23, 30, November 6, 2008 Metro Courier October 22, 2008 cc: Tameka Allen Interim Deputy Administrator Ron Crowden Fleet Management Attachment number 4Page 1 of 1 Vendors 5.00 Vehicle/Options Required Bid Price Model Bid Price Model Bid Price Model 5.01 $ 14,876.00 Ford F-150 5.02 $ 18,606.00 Ford F-150 5.03 $ 21,367.00 Ford F-150 5.04 $ 16,349.00 Ford F-150 5.05 $ 19,835.00 Ford F-150 5.06 $ 22,475.00 Ford F-150 5.07 $ 187.00 5.08 Standard 5.09 incl in trailer tow ($291.00) 5.10 Standard 5.11 $ 2,752.00 5.12 $ 133.00 5.13 271.00$ 5.14 291.00$ 6.00 Outfitter's Specialty Items 6.01 40.00$ 6.02 45.00$ 6.03 275.00$ 6.04 232.00$ 6.05 175.00$ 6.06 25.00$ 6.07 $ 10.00 6.08 $ 85.00 6.09 $ 95.00 6.10 $ 40.00 6.11 $ 105.00 7.00 Alert Warning Systems 7.01 50.00$ 7.02 320.00$ 7.03 407.00$ Approximate Delivery Time 90 - 120 day from getting P.O. Non-Compliant Contractors Affidavit (Notary); Sub-Contractor Affidavit (Incomplete) LSB Forms Non-Compliant Sub-Contractor Affidavit (Incomplete) LSB (Sub/Supplier) Gordon Chevrolet 2031 Gordon Highway Augusta, GA 30909 Bid #08-189 2009 - 6000 GVW Series Pickup Truck for The City of Augusta - Fleet Department Bid Opening Date: Friday, November 14, 2008 at 11:00 a.m. Bobby Jones Ford P.O. Box 15398 Augusta, GA 30919 Legacy Ford, Inc. 413 Industrial Boulevard McDonough, GA 30253 Attachment number 5Page 1 of 1 Attachment number 6Page 1 of 2 Attachment number 6Page 2 of 2 Invitation To Bid Sealed bids will be received at this office until 11:00 a.m. Tuesday, November 25, 2008 Bid Item #08-197 2009 – 10,000 GVW Series Pickup Truck for Fleet Department Bid Item #08-198 2009 – 15,000 GVW Series Truck for Fleet Department Bid Item #08-199 2009 – Mid-Size Sports Utility Vehicle for Fleet Department BID’s will be received by Augusta, GA Commission hereinafter referred to as the OWNER at the offices of: Geri A. Sams Procurement Department 530 Greene Street - Room 605 Augusta, Georgia 30901 706-821-2422 BID documents may be obtained at the office of Augusta, GA Procurement Department, 530 Greene Street – Room 605, Augusta, GA 30901. Documents may be examined during regular business hours at the offices of Augusta, GA Procurement Department. All questions must be submitted in writing to the office of the Procurement Department by Fax at 706-821-2811 or by mail. No bid will be accepted by fax, all must be received by mail or hand delivered. The local bidder preference program is applicable to this project. To be approved as a local bidder and receive bid preference on an eligible local project, the certification statement as a local bidder and all supporting documents must be submitted to the Procurement Department with your bonafide bid package. No BID may be withdrawn for a period of 90 days after time has been called on the date of opening. Bidders will please note that the number of copies requested; all supporting documents including financial statements and references and such other attachments that may be required by the bid invitation are material conditions of the bid. Any package found incomplete or submitted late shall be rejected by the Procurement Office. Any bidder allegedly contending that he/she has been improperly disqualified from bidding due to an incomplete bid submission shall have the right to appeal to the appropriate committee of the Augusta commission. Please mark BID number on the outside of the envelope. Bidders are cautioned that sequestration of BID documents through any source other than the office of the Procurement Department is not advisable. Acquisition of BID documents from unauthorized sources placed the bidder at the risk of receiving incomplete or inaccurate information upon which to base his qualifications. GERI A. SAMS, Procurement Director Publish: Augusta Chronicle October 23, 30, November 6, 13, 2008 Metro Courier October 29, 2008 cc: Tameka Allen Interim Deputy Administrator Ron Crowden Fleet Management Attachment number 7Page 1 of 1 Vendors Terry Cullen Chev 1250 Battlecreek Rd Jonesboro, GA 30236 Legacy Ford, Inc. 413 Industrial Blvd McDonough, GA 30253 Gordon Chevrolet 2031 Gordon Highway Augusta, GA 30909 Bobby Jones Ford P.O. Box 15398 Augusta, GA 30919 Delivery Date 60 to 100 Days ARO 60 Days ARO 90 - 120 From PO 5.00 Options 5.01 22,490.00$ 21,590.00$ 22,371.00$ 5.02 24,690.00$ 23,662.00$ 24,863.00$ 5.03 32,190.00$ No Bid 26,504.00$ 5.04 Standard 0.00 234.00$ 5.05 Not Avail Trailblazer No charge w/Tahoe N/A N/A 6.00 Outfitter's Specialty Items 6.01 75.00$ 45.00$ 40.00$ 6.02 50.00$ 47.00$ 45.00$ 6.03 160.00$ 60.00$ 50.00$ 6.04 Standard 25.00$ 210.00$ 6.05 Standard 0.00 75.00$ 7.00 Alert Warning Systems 7.01 2,100.00$ 1,800.00$ 1,720.00$ 7.02 180.00$ 110.00$ 95.00$ 7.03 340.00$ 307.00$ 307.00$ 7.04 350.00$ 490.00$ 420.00$ 7.05 210.00$ 150.00$ 115.00$ 7.06 340.00$ 300.00$ 260.00$ 7.07 340.00$ 300.00$ 260.00$ 7.08 360.00$ Will Not Fit $ 355.00 See Exception 7.09 90.00$ 14.00$ 0.00 7.10 90.00$ 75.00$ 50.00$ 7.11 410.00$ 335.00$ 320.00$ 7.12 460.00$ 469.00$ 407.00$ Bid Item #08-199 2009 - Mid-Size Sports Utility Vehicle Fleet Department Bid Opening Date: Tuesday, November 25, 2008 @ 11:00 a.m. Non-Compliant LSB (Good Faith Effort) Attachment number 8Page 1 of 1 Attachment number 9Page 1 of 1 Attachment number 10Page 1 of 2 Attachment number 10Page 2 of 2 Attachment number 11Page 1 of 1 Commission Meeting Agenda 3/17/2009 12:00 PM 2009 Utilities -Customer Service Light Trucks Department:Finance Department, Fleet Management Division Caption:Motion to approve the replacement of 4 compact pickup trucks and 2 utility body trucks for the Utilities Department-Customer Service Division (Approved by Finance Committee March 9, 2009) Background:The Utilities Department – Customer Service is requesting the replacement of four light pickup trucks, asset numbers 994153, F00099, F00101 and F00110, and two full size utility body trucks, asset numbers F00104 and F00106 for meter reading and repair service employees. Each truck has been evaluated and exceeds the replacement criteria approved by the Augusta Commission in April 2004. The trucks have extreme idle time, excessive miles, and are recommended for replacement. Evaluation sheets are provided as attachments for Commission review. Analysis:Fleet Management submitted a request for bids through the Procurement Department utilizing the Demand Star electronic bid system which offers nationwide bid coverage. For the compact pickup truck, Bid 08-188, the Procurement Department received quotes back from three venders with only one being compliant. Review of bids received show the following results: Bobby Jones Ford = $ 16,216.00 each; Legacy Ford as noncompliant; and, Gordon Chevrolet as non compliant. For the full size utility body truck, Bid 08-190, two bids were received as follows: Bobby Jones = $24,694.00; and Legacy Ford as non compliant Financial Impact:The vehicles will be purchased for a total of $ 114,252.00. Funding for the procurement of this equipment will be provided by the Utilities Department capital outlay. Alternatives:1.Approve the award to the lowest and only compliant bidder, Bobby Jones Ford, Augusta Georgia 2. Do not approve the request. Recommendation:Approve the acquisition of three Ford Rangers and two F250 utility body trucks from Bobby Jones Ford (lowest Bid offer -08-188 & 08-190) for $114,252 for the Utilities Department – Customer Service division. Funds are Available in the Following Accounts: 506-04-3210/54.22210 (Utilities-Customer Service Captial) Cover Memo REVIEWED AND APPROVED BY: Finance. Procurement. Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 6 Attachment number 1Page 2 of 6 Attachment number 1Page 3 of 6 Attachment number 1Page 4 of 6 Attachment number 1Page 5 of 6 Attachment number 1Page 6 of 6 20 0 9 C O M P A C T P I C K U P T R U C K S BI D 0 8 - 1 8 8 Bo b b y J o n e s Le g a c y Go r d o n Fo r d Fo r d Ch e v r o l e t Ye a r 20 0 9 Br a n d Fo r d Mo d e l Ra n g e r De l i v e r y D a t e 90 D a y s 5. 0 1 Mo d e l - E C - 4 x 2 ( 4 C y l ) $1 5 , 0 0 4 . 0 0 $ 0 . 0 0 $ 0 . 0 0 5. 0 2 Mo d e l - E C - 4 x 2 ( 6 C y l ) $1 6 , 0 4 4 . 0 0 $ 0 . 0 0 $ 0 . 0 0 5. 0 2 Mo d e l - E C - 4 x 4 ( 6 C y l ) $1 8 , 5 5 8 . 0 0 $ 0 . 0 0 $ 0 . 0 0 6. 0 0 OU T F I T T E R ' S S P E C I A L T Y I T E M S 6. 0 1 Fi r e E x t i n g u i s h e r 40 . 0 0 0 . 0 0 0 . 0 0 6. 0 2 Th r e e P l u g O u t l e t R e c e p t a c l e 45 . 0 0 0 . 0 0 0 . 0 0 6. 0 3 Be d L i n e r 27 5 . 0 0 0 . 0 0 0 . 0 0 6. 0 4 To o l B o x 24 5 . 0 0 0 . 0 0 0 . 0 0 6. 0 5 Cl a s s I I I T r a i l e r H i t c h 19 0 . 0 0 0 . 0 0 0 . 0 0 6. 0 6 Tr a i l e r W i r i n g 30 . 0 0 0 . 0 0 0 . 0 0 6. 0 7 2" T r a i l e r B a l l 12 . 0 0 0 . 0 0 0 . 0 0 6. 0 8 Wi n d o w T i n t 90 . 0 0 0 . 0 0 0 . 0 0 6. 0 9 Sa f e t y C o n e H o l d e r 40 . 0 0 0 . 0 0 0 . 0 0 6. 1 0 Sa f e t y C o n e s 10 5 . 0 0 0 . 0 0 0 . 0 0 7. 0 0 AL E R T W A R N I N G S Y S T E M S 7. 0 1 Ba c k u p A l a r m 50 . 0 0 0 . 0 0 0 . 0 0 7. 0 3 Ca b M o u n t L E D F l a s h i o n g L i g h t 40 7 . 0 0 0 . 0 0 0 . 0 0 NO N - C O M P L I A N T NO N - C O M P L I A N T FO R A L L D E P A R T M E N T S - C O M P A C T P I C K U P T R U C K - B I D O P E N I N G N O V E M B E R 1 4 @ 1 1 : 0 0 Attachment number 2Page 1 of 1 8500 GVW TRUCKS BID 08-190 Bobby Jones Legacy Required Ford Ford Items Year 2009 2009 Brand Ford Ford Model F250 F250 Delivery Date 120 Days 5.01 Model -8,500-RC-4x2 $18,087.00 $0.00 5.01 $18,087.00 5.02 Model - 8,500-RC-4x4 $20,775.00 $0.00 5.03 Model - 8,500-EC-4x2 $20,110.00 $0.00 5.04 Model - 8,500 -EC-4x4 $22,798.00 $0.00 5.05 Model - 8,500 -Crew Cab-4x2 $21,293.00 $0.00 5.06 Model - 8,500 -Crew Cab-4x4 $23,982.00 $0.00 5.07 Diesel Engine 6.0 L 5,723.00 0.00 5.08 Limited Slip Rear Axle 249.00 0.00 5.08 249.00 5.09 HD Cooling Package 0.00 0.00 5.09 0.00 5.10 HD Electrical Package 0.00 0.00 5.10 0.00 5.11 Rear Seat Deleted n/a 5.12 Pickup Box Deleted -307.00 0.00 5.12 -307.00 5.13 Trailer Tow Mirrors 0.00 0.00 5.13 0.00 5.14 Roof Clearance Lights 46.00 0.00 5.15 Speed Control/Tilt Steering 320.00 0.00 5.16 Skid Plate Package 4x4 83.00 0.00 6.00 OUTFITTER'S SPECIALTY ITEMS 6.01 Fire Extinguisher 40.00 0.00 6.01 40.00 6.02 Three Plug Outlet Receptacle 45.00 0.00 6.03 Bed Liner 275.00 0.00 6.04 Electric Brake Controller 120.00 0.00 6.04 120.00 6.05 8' Service Body 5,000.00 0.00 6.05 5,000.00 6.06 Service Body Bumper-Ball Hitch 326.00 0.00 6.07 Service Body Bumper-Pintle Hook 253.00 0.00 6.07 253.00 6.08 Single Spotlight 245.00 0.00 6.08 245.00 6.09 Dual Spotlights 490.00 0.00 6.10 Tool Box-Alumunium 232.00 0.00 6.11 Class IV Trailer Hitch 300.00 0.00 6.12 Trailer Wiring 30.00 0.00 6.12 30.00 6.13 Trailer Ball 12.00 0.00 6.14 Pintle Hook-Dual Purpose 120.00 0.00 6.14 120.00 6.15 Pipe Vise-Rigid Model 40195 215.00 0.00 6.15 215.00 6.16 Tommy Gate Lift 2,000.00 0.00 6.17 Window Tint-Regular Cab 80.00 0.00 6.17 80.00 6.18 Window Tint-Extended Cab 95.00 0.00 6.19 Window Tint-Crew Cab 125.00 0.00 6.20 Safety Cone Holder 40.00 0.00 6.21 Safety Cones-4 105.00 0.00 6.21 105.00 7.00 ALERT WARNING SYSTEMS 7.01 Backup Alarm 50.00 0.00 7.01 50.00 7.02 Magnetic LED Cab Light 320.00 0.00 7.03 Cab Mount LED Light 407.00 0.00 7.03 407.00 NON-COMPLIANT $24,694.00 FOR ALL DEPARTMENTS-8500 GVW TRUCKS-BIDS OPENED NOVEMBER 14 @ 11:00 Attachment number 3Page 1 of 4 8500 GVW TRUCKS BID 08-190 Bobby Jones Ford Year 2009 Brand Ford Model F250 Delivery Date 120 Days 5.01 Model -8,500-RC-4x2 $18,087.00 5.01 $18,087.00 5.02 Model - 8,500-RC-4x4 $20,775.00 5.03 Model - 8,500-EC-4x2 $20,110.00 5.04 Model - 8,500 -EC-4x4 $22,798.00 5.05 Model - 8,500 -Crew Cab-4x2 $21,293.00 5.06 Model - 8,500 -Crew Cab-4x4 $23,982.00 5.07 Diesel Engine 6.0 L 5,723.00 5.08 Limited Slip Rear Axle 249.00 5.08 249.00 5.09 HD Cooling Package 0.00 5.09 0.00 5.10 HD Electrical Package 0.00 5.10 0.00 5.11 Rear Seat Deleted n/a 5.12 Pickup Box Deleted -307.00 5.12 -307.00 5.13 Trailer Tow Mirrors 0.00 5.13 0.00 5.14 Roof Clearance Lights 46.00 5.15 Speed Control/Tilt Steering 320.00 5.16 Skid Plate Package 4x4 83.00 6.00 OUTFITTER'S SPECIALTY ITEMS 6.01 Fire Extinguisher 40.00 6.01 40.00 6.02 Three Plug Outlet Receptacle 45.00 6.03 Bed Liner 275.00 6.04 Electric Brake Controller 120.00 6.04 120.00 6.05 8' Service Body 5,000.00 6.05 5,000.00 6.06 Service Body Bumper-Ball Hitch 326.00 6.07 Service Body Bumper-Pintle Hook 253.00 6.07 253.00 6.08 Single Spotlight 245.00 6.08 245.00 6.09 Dual Spotlights 490.00 6.10 Tool Box-Alumunium 232.00 6.11 Class IV Trailer Hitch 300.00 6.12 Trailer Wiring 30.00 6.12 30.00 6.13 Trailer Ball 12.00 6.14 Pintle Hook-Dual Purpose 120.00 6.14 120.00 6.15 Pipe Vise-Rigid Model 40195 215.00 6.15 215.00 6.16 Tommy Gate Lift 2,000.00 6.17 Window Tint-Regular Cab 80.00 6.17 80.00 6.18 Window Tint-Extended Cab 95.00 6.19 Window Tint-Crew Cab 125.00 6.20 Safety Cone Holder 40.00 6.21 Safety Cones-4 105.00 6.21 105.00 6.22 Ladder Rack 395.00 6.22 395.00 7.00 ALERT WARNING SYSTEMS 7.01 Backup Alarm 50.00 7.01 50.00 7.02 Magnetic LED Cab Light 320.00 7.03 Cab Mount LED Light 407.00 7.03 407.00 Total $25,089.00 FOR ALL DEPARTMENTS-8500 GVW TRUCKS-BIDS OPENED NOVEMBER 14 @ 11:00 Attachment number 3Page 2 of 4 8500 GVW TRUCKS BID 08-190 Bobby Jones Ford Year 2009 Brand Ford Model F250 Delivery Date 120 Days 5.01 Model -8,500-RC-4x2 $18,087.00 5.02 Model - 8,500-RC-4x4 $20,775.00 5.03 Model - 8,500-EC-4x2 $20,110.00 5.03 $20,110.00 5.04 Model - 8,500 -EC-4x4 $22,798.00 5.05 Model - 8,500 -Crew Cab-4x2 $21,293.00 5.06 Model - 8,500 -Crew Cab-4x4 $23,982.00 5.07 Diesel Engine 6.0 L 5,723.00 5.08 Limited Slip Rear Axle 249.00 5.08 249.00 5.09 HD Cooling Package 0.00 5.10 HD Electrical Package 0.00 5.11 Rear Seat Deleted n/a 5.12 Pickup Box Deleted -307.00 5.13 Trailer Tow Mirrors 0.00 5.14 Roof Clearance Lights 46.00 5.15 Speed Control/Tilt Steering 320.00 5.16 Skid Plate Package 4x4 83.00 6.00 OUTFITTER'S SPECIALTY ITEMS 6.01 Fire Extinguisher 40.00 6.01 40.00 6.02 Three Plug Outlet Receptacle 45.00 6.03 Bed Liner 275.00 6.03 275.00 6.04 Electric Brake Controller 120.00 6.04 120.00 6.05 8' Service Body 5,000.00 6.06 Service Body Bumper-Ball Hitch 326.00 6.07 Service Body Bumper-Pintle Hook 253.00 6.08 Single Spotlight 245.00 6.09 Dual Spotlights 490.00 6.10 Tool Box-Alumunium 232.00 6.10 232.00 6.11 Class IV Trailer Hitch 300.00 6.11 300.00 6.12 Trailer Wiring 30.00 6.12 30.00 6.13 Trailer Ball 12.00 6.14 Pintle Hook-Dual Purpose 120.00 6.14 120.00 6.15 Pipe Vise-Rigid Model 40195 215.00 6.16 Tommy Gate Lift 2,000.00 6.17 Window Tint-Regular Cab 80.00 6.18 Window Tint-Extended Cab 95.00 6.18 95.00 6.19 Window Tint-Crew Cab 125.00 6.20 Safety Cone Holder 40.00 6.21 Safety Cones-4 105.00 6.21 105.00 7.00 ALERT WARNING SYSTEMS 7.01 Backup Alarm 50.00 7.01 50.00 7.02 Magnetic LED Cab Light 320.00 7.03 Cab Mount LED Light 407.00 7.03 407.00 Total $22,133.00 FOR ALL DEPARTMENTS-8500 GVW TRUCKS-BIDS OPENED NOVEMBER 14 @ 11:00 Attachment number 3Page 3 of 4 8500 GVW TRUCKS BID 08-190 Bobby Jones Ford Year 2009 Brand Ford Model F250 Delivery Date 120 Days 5.01 Model -8,500-RC-4x2 $18,087.00 5.02 Model - 8,500-RC-4x4 $20,775.00 5.02 $20,775.00 5.03 Model - 8,500-EC-4x2 $20,110.00 5.04 Model - 8,500 -EC-4x4 $22,798.00 5.05 Model - 8,500 -Crew Cab-4x2 $21,293.00 5.06 Model - 8,500 -Crew Cab-4x4 $23,982.00 5.07 Diesel Engine 6.0 L 5,723.00 5.08 Limited Slip Rear Axle 249.00 5.08 249.00 5.09 HD Cooling Package 0.00 5.10 HD Electrical Package 0.00 5.11 Rear Seat Deleted n/a 5.12 Pickup Box Deleted -307.00 5.13 Trailer Tow Mirrors 0.00 5.14 Roof Clearance Lights 46.00 5.15 Speed Control/Tilt Steering 320.00 5.16 Skid Plate Package 4x4 83.00 5.16 83.00 6.00 OUTFITTER'S SPECIALTY ITEMS 6.01 Fire Extinguisher 40.00 6.01 40.00 6.02 Three Plug Outlet Receptacle 45.00 6.03 Bed Liner 275.00 6.03 275.00 6.04 Electric Brake Controller 120.00 6.04 120.00 6.05 8' Service Body 5,000.00 6.06 Service Body Bumper-Ball Hitch 326.00 6.07 Service Body Bumper-Pintle Hook 253.00 6.08 Single Spotlight 245.00 6.09 Dual Spotlights 490.00 6.10 Tool Box-Alumunium 232.00 6.10 232.00 6.11 Class IV Trailer Hitch 300.00 6.11 300.00 6.12 Trailer Wiring 30.00 6.12 30.00 6.13 Trailer Ball 12.00 6.14 Pintle Hook-Dual Purpose 120.00 6.14 120.00 6.15 Pipe Vise-Rigid Model 40195 215.00 6.16 Tommy Gate Lift 2,000.00 6.17 Window Tint-Regular Cab 80.00 6.17 80.00 6.18 Window Tint-Extended Cab 95.00 6.19 Window Tint-Crew Cab 125.00 6.20 Safety Cone Holder 40.00 6.21 Safety Cones-4 105.00 6.21 105.00 7.00 ALERT WARNING SYSTEMS 7.01 Backup Alarm 50.00 7.01 50.00 7.02 Magnetic LED Cab Light 320.00 7.03 Cab Mount LED Light 407.00 7.03 407.00 Total $22,866.00 FOR ALL DEPARTMENTS-8500 GVW TRUCKS-BIDS OPENED NOVEMBER 14 @ 11:00 Attachment number 3Page 4 of 4 Invitation To Bid Sealed bids will be received at this office until 11:00 a.m. Friday, November 14, 2008 Bid Item #08-188 2009 – Compact Pickup Truck for Fleet Department Bid Item #08-189 2009 – 6000 GVW Series Pickup Truck for Fleet Department Bid Item #08-190 2009 – 8500 GVW Series Pickup Truck for Fleet Department Bid Item #08-196 2009 – Police Impala for Fleet Department BID’s will be received by Augusta, GA Commission hereinafter referred to as the OWNER at the offices of: Geri A. Sams Procurement Department 530 Greene Street - Room 605 Augusta, Georgia 30901 706-821-2422 BID documents may be obtained at the office of Augusta, GA Procurement Department, 530 Greene Street – Room 605, Augusta, GA 30901. Documents may be examined during regular business hours at the offices of Augusta, GA Procurement Department. All questions must be submitted in writing to the office of the Procurement Department by Fax at 706-821-2811 or by mail. No bid will be accepted by fax, all must be received by mail or hand delivered. The local bidder preference program is applicable to this project. To be approved as a local bidder and receive bid preference on an eligible local project, the certification statement as a local bidder and all supporting documents must be submitted to the Procurement Department with your bonafide bid package. No BID may be withdrawn for a period of 90 days after time has been called on the date of opening. Bidders will please note that the number of copies requested; all supporting documents including financial statements and references and such other attachments that may be required by the bid invitation are material conditions of the bid. Any package found incomplete or submitted late shall be rejected by the Procurement Office. Any bidder allegedly contending that he/she has been improperly disqualified from bidding due to an incomplete bid submission shall have the right to appeal to the appropriate committee of the Augusta commission. Please mark BID number on the outside of the envelope. Bidders are cautioned that sequestration of BID documents through any source other than the office of the Procurement Department is not advisable. Acquisition of BID documents from unauthorized sources placed the bidder at the risk of receiving incomplete or inaccurate information upon which to base his qualifications. GERI A. SAMS, Procurement Director Publish: Augusta Chronicle October 16, 23, 30, November 6, 2008 Metro Courier October 22, 2008 cc: Tameka Allen Interim Deputy Administrator Ron Crowden Fleet Management Attachment number 4Page 1 of 1 Vendors Bobby Jones Ford P.O. Box 15398 Augusta, GA 30919 Legacy Ford, Inc. 413 Industrial Boulevard McDonough, GA 30253 Gordon Chevrolet 2031 Gordon Highway Augusta, GA 30909 5.00 Vehicle/Options Required 5.01 15,004.00$ 5.02 16,044.00$ 5.03 $ 18,558.00 6.00 Outfiter's Specialty Items 6.01 $ 40.00 6.02 $ 45.00 6.03 $ 275.00 6.04 245.00$ 6.05 $ 190.00 6.06 $ 30.00 6.07 $ 12.00 6.08 $ 90.00 6.09 40.00$ 6.10 105.00$ 7.00 Alert Warning Systems 7.01 50.00$ 7.02 407.00$ Approximate Delivery Time 90 - 120 Days from receipt of P.O. Bid #08-188 2009 - Compact Pickup Truck for The City of Augusta - Fleet Department Bid Opening Date: Friday, November 14, 2008 at 11:00 a.m. Non-Compliant Contractors Affidavit (Notary); Sub- Contractors Affidavit; LSB Forms Non-Compliant Sub-Contractors Affidavit (Incomplete) Attachment number 5Page 1 of 1 Attachment number 6Page 1 of 3 Attachment number 6Page 2 of 3 Attachment number 6Page 3 of 3 Attachment number 7Page 1 of 1 Invitation To Bid Sealed bids will be received at this office until 11:00 a.m. Friday, November 14, 2008 Bid Item #08-188 2009 – Compact Pickup Truck for Fleet Department Bid Item #08-189 2009 – 6000 GVW Series Pickup Truck for Fleet Department Bid Item #08-190 2009 – 8500 GVW Series Pickup Truck for Fleet Department Bid Item #08-196 2009 – Police Impala for Fleet Department BID’s will be received by Augusta, GA Commission hereinafter referred to as the OWNER at the offices of: Geri A. Sams Procurement Department 530 Greene Street - Room 605 Augusta, Georgia 30901 706-821-2422 BID documents may be obtained at the office of Augusta, GA Procurement Department, 530 Greene Street – Room 605, Augusta, GA 30901. Documents may be examined during regular business hours at the offices of Augusta, GA Procurement Department. All questions must be submitted in writing to the office of the Procurement Department by Fax at 706-821-2811 or by mail. No bid will be accepted by fax, all must be received by mail or hand delivered. The local bidder preference program is applicable to this project. To be approved as a local bidder and receive bid preference on an eligible local project, the certification statement as a local bidder and all supporting documents must be submitted to the Procurement Department with your bonafide bid package. No BID may be withdrawn for a period of 90 days after time has been called on the date of opening. Bidders will please note that the number of copies requested; all supporting documents including financial statements and references and such other attachments that may be required by the bid invitation are material conditions of the bid. Any package found incomplete or submitted late shall be rejected by the Procurement Office. Any bidder allegedly contending that he/she has been improperly disqualified from bidding due to an incomplete bid submission shall have the right to appeal to the appropriate committee of the Augusta commission. Please mark BID number on the outside of the envelope. Bidders are cautioned that sequestration of BID documents through any source other than the office of the Procurement Department is not advisable. Acquisition of BID documents from unauthorized sources placed the bidder at the risk of receiving incomplete or inaccurate information upon which to base his qualifications. GERI A. SAMS, Procurement Director Publish: Augusta Chronicle October 16, 23, 30, November 6, 2008 Metro Courier October 22, 2008 cc: Tameka Allen Interim Deputy Administrator Ron Crowden Fleet Management Attachment number 8Page 1 of 1 Vendors Bobby Jones Ford P.O. Box 15398 Augusta, GA 30919 Legacy Ford, Inc. 413 Industrial Boulevard McDonough, GA 30253 Gordon Chevrolet 2031 Gordon Highway Augusta, GA 30909 5.00 Vehicle/Options Required 5.01 18,087.00$ 5.02 $ 20,775.00 5.03 $ 20,110.00 5.04 $ 22,798.00 5.05 $ 21,293.00 5.06 $ 23,982.00 5.07 5,723.00$ 5.08 $ 249.00 5.09 Standard 5.10 Standard 5.11 N/A 5.12 (307.00)$ 5.13 Standard 5.14 46.00$ 5.15 320.00$ 5.16 83.00$ 6.00 Outfitter's Speciality Items 6.01 40.00$ 6.02 45.00$ 6.03 275.00$ 6.04 $ 120.00 6.05 $ 5,000.00 6.06 $ 326.00 6.07 $ 253.00 6.08 $ 245.00 6.09 490.00$ 6.10 232.00$ 6.11 300.00$ 6.12 30.00$ 6.13 12.00$ 6.14 120.00$ 6.15 215.00$ 6.16 2,000.00$ 6.17 80.00$ 6.18 $ 95.00 6.19 125.00$ 6.20 40.00$ 6.21 105.00$ 7.00 Alert Warning Systems 7.01 50.00$ 7.02 320.00$ 7.03 407.00$ Approximate Delivery Time 90 - 120 days after PO Bid #08-190 2009 - 8500 GVW Series Pickup Truck for The City of Augusta - Fleet Department Bid Opening Date: Friday, November 14, 2008 at 11:00 a.m. Non-Compliant Contractors Affidavit (Notary) Sub-Contractors Affidavit LSB Forms Non-Compliant Contractors Affidavit (Notary) Sub-Contractors Affidavit LSB Forms Attachment number 9Page 1 of 1 Attachment number 10Page 1 of 2 Attachment number 10Page 2 of 2 Attachment number 11Page 1 of 1 Commission Meeting Agenda 3/17/2009 12:00 PM 2009 Utilities Rangers Department:Finance Department, Fleet Management Division Caption:Motion to approve the replacement of 6 compact pickup trucks of the Utilities Department, Water Production and Construction and Maintenance Divisions. (Approved by Finance Committee March 9, 2009) Background:The Utilities Department – Water Production Division is requesting the replacement of four light pickup trucks and 2 compact pickup trucks trucks for Construction and Maintenance Division. The asset numbers are: F02093 (133,693 miles), 994451 (173,916 miles), 984157 (111,834 miles), 994452 (182,804 miles), F00091 (121,282 miles), and 994148 (99,408 miles) Each truck has been evaluated and exceeds the replacement criteria approved by the Augusta Commission in April 2004. The trucks have extreme idle time, excessive miles, and are recommended for replacement. Evaluation sheets are provided as attachments for Commission review. Analysis:Fleet Management submitted a request for bids through the Procurement Department utilizing the Demand Star electronic bid system which offers nationwide bid coverage. For the compact pickup truck, Bid 08-188, the Procurement Department received quotes back from three venders with only one being compliant. Review of bids received show the following results: Bobby Jones Ford = $ 16,216.00 each; Legacy Ford as noncompliant; and, Gordon Chevrolet as non compliant. Financial Impact:The vehicles will be purchased for a total of $ 97,296.00. Funding for the procurement of this equipment will be provided by the Utilities Department capital outlay. Alternatives:1. Approve the award to the lowest and only compliant bidder, Bobby Jones Ford, Augusta Georgia 2. Do not approve the request. Recommendation:Approve the acquisition of six Ford Rangers from Bobby Jones Ford (lowest Bid offer -08-188) for $97,296.00 for the Utilities Department – Water Production Division (Highland Ave, Hick Plant, and Ground Water) and Construction and Maintenance Division. Funds are Available in the Following Accounts: Highland Ave Plant - $16,216.00 - 506-04-3520/54.22210 Ground Water – $16,216.00 - 506-04-3530/54.22210 Hicks Plant –$32,432.00 -506-04- 3540/54.22210 Construction - $32,432.00 – 506-04-3410/ 54.22210Cover Memo REVIEWED AND APPROVED BY: Finance. Procurement. Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 6 Attachment number 1Page 2 of 6 Attachment number 1Page 3 of 6 Attachment number 1Page 4 of 6 Attachment number 1Page 5 of 6 Attachment number 1Page 6 of 6 BID 08-188 Bobby Jones Legacy Gordon Required Ford Ford Chevrolet Items Year 2009 Brand Ford Model Ranger Delivery Date 90 Days 5.01 Model -EC-4x2 (4 Cyl)$15,004.00 $0.00 $0.00 $5.01 $15,004.00 5.02 Model -EC-4x2 (6 Cyl)$16,044.00 $0.00 $0.00 5.02 Model -EC-4x4 (6Cyl)$18,558.00 $0.00 $0.00 6.00 OUTFITTER'S SPECIALTY ITEMS 6.01 Fire Extinguisher 40.00 0.00 0.00 6.01 40.00 6.02 Three Plug Outlet Receptacle 45.00 0.00 0.00 6.03 Bed Liner 275.00 0.00 0.00 6.03 275.00 6.04 ToolBox 245.00 0.00 0.00 6.04 245.00 6.05 Class III Trailer Hitch 190.00 0.00 0.00 6.06 Trailer Wiring 30.00 0.00 0.00 6.07 2" Trailer Ball 12.00 0.00 0.00 6.08 Window Tint 90.00 0.00 0.00 6.06 90.00 6.09 Safety Cone Holder 40.00 0.00 0.00 6.10 Safety Cones 105.00 0.00 0.00 6.08 105.00 7.00 ALERT WARNING SYSTEMS 7.01 Backup Alarm 50.00 0.00 0.00 7.01 50.00 7.03 Cab Mount LED Flashiong Light 407.00 0.00 0.00 7.02 407.00 NON- COMPLIA NT NON- COMPLIA NT $16,216.00 FOR ALL DEPARTMENTS-COMPACT PICKUP TRUCK- Attachment number 2Page 1 of 1 Attachment number 3Page 1 of 1 Invitation To Bid Sealed bids will be received at this office until 11:00 a.m. Friday, November 14, 2008 Bid Item #08-188 2009 – Compact Pickup Truck for Fleet Department Bid Item #08-189 2009 – 6000 GVW Series Pickup Truck for Fleet Department Bid Item #08-190 2009 – 8500 GVW Series Pickup Truck for Fleet Department Bid Item #08-196 2009 – Police Impala for Fleet Department BID’s will be received by Augusta, GA Commission hereinafter referred to as the OWNER at the offices of: Geri A. Sams Procurement Department 530 Greene Street - Room 605 Augusta, Georgia 30901 706-821-2422 BID documents may be obtained at the office of Augusta, GA Procurement Department, 530 Greene Street – Room 605, Augusta, GA 30901. Documents may be examined during regular business hours at the offices of Augusta, GA Procurement Department. All questions must be submitted in writing to the office of the Procurement Department by Fax at 706-821-2811 or by mail. No bid will be accepted by fax, all must be received by mail or hand delivered. The local bidder preference program is applicable to this project. To be approved as a local bidder and receive bid preference on an eligible local project, the certification statement as a local bidder and all supporting documents must be submitted to the Procurement Department with your bonafide bid package. No BID may be withdrawn for a period of 90 days after time has been called on the date of opening. Bidders will please note that the number of copies requested; all supporting documents including financial statements and references and such other attachments that may be required by the bid invitation are material conditions of the bid. Any package found incomplete or submitted late shall be rejected by the Procurement Office. Any bidder allegedly contending that he/she has been improperly disqualified from bidding due to an incomplete bid submission shall have the right to appeal to the appropriate committee of the Augusta commission. Please mark BID number on the outside of the envelope. Bidders are cautioned that sequestration of BID documents through any source other than the office of the Procurement Department is not advisable. Acquisition of BID documents from unauthorized sources placed the bidder at the risk of receiving incomplete or inaccurate information upon which to base his qualifications. GERI A. SAMS, Procurement Director Publish: Augusta Chronicle October 16, 23, 30, November 6, 2008 Metro Courier October 22, 2008 cc: Tameka Allen Interim Deputy Administrator Ron Crowden Fleet Management Attachment number 4Page 1 of 1 Vendors Bobby Jones Ford P.O. Box 15398 Augusta, GA 30919 Legacy Ford, Inc. 413 Industrial Boulevard McDonough, GA 30253 Gordon Chevrolet 2031 Gordon Highway Augusta, GA 30909 5.00 Vehicle/Options Required 5.01 15,004.00$ 5.02 16,044.00$ 5.03 $ 18,558.00 6.00 Outfiter's Specialty Items 6.01 $ 40.00 6.02 $ 45.00 6.03 $ 275.00 6.04 245.00$ 6.05 $ 190.00 6.06 $ 30.00 6.07 $ 12.00 6.08 $ 90.00 6.09 40.00$ 6.10 105.00$ 7.00 Alert Warning Systems 7.01 50.00$ 7.02 407.00$ Approximate Delivery Time 90 - 120 Days from receipt of P.O. Bid #08-188 2009 - Compact Pickup Truck for The City of Augusta - Fleet Department Bid Opening Date: Friday, November 14, 2008 at 11:00 a.m. Non-Compliant Contractors Affidavit (Notary); Sub- Contractors Affidavit; LSB Forms Non-Compliant Sub-Contractors Affidavit (Incomplete) Attachment number 5Page 1 of 1 Attachment number 6Page 1 of 3 Attachment number 6Page 2 of 3 Attachment number 6Page 3 of 3 Commission Meeting Agenda 3/17/2009 12:00 PM Clean Augusta Downtown Initiative, Inc(CADI) Memorandum of Understanding Department:Finance Caption:Motion to approve Memorandum of Understanding with Clean Augusta Downtown Initiative, Inc. with quarterly payments and a 2% administrative fee to be collected on the amount that was advanced. (Approved by Finance Committee March 9, 2009) Background:The Clean Augusta Downtown Initiative was created in 2008 and is funded by the revenues from the Business Improvement District (BID). Because of the timing of the availability ofthe funds a Memorandum of Understanding was entered into to allow funds to be disbursed before the revenues are collected . Analysis:The 2009 revenues will be collected when property taxes are paid. Approving this MOU will allow the funds to be disbursed before being collected. This is a continuation of the procedure that was developed and approved in 2008 for this program. Financial Impact:The 2009 MOU approves advancing a portion of the anticipated collections. Total projected revenues for 2009 are $343,000. Alternatives:None Recommendation:approve MOU Funds are Available in the Following Accounts: 271-07-5520/5721110 REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo 1 MEMORANDUM OF UNDERSTANDING THIS CONTRACT and AGREEMENT (hereinafter referred to as ³Agreement´) was made and entered into this ___ day of February 2009, by and between the Augusta-Richmond County (hereinafter referred to as "ARC"), a political subdivision of the State of Georgia through its Board of Commissioners, KHUHLQDIWHU³%oard´ and Clean Augusta Downtown Initiative, Inc. (hereinafter referred to as "CADI"). WHEREAS, the Georgia General Assembly saw a necessity for revitalizing established city business districts which are deteriorating in large cities of Georgia and established the City Business Improvement District Act KHUHLQDIWHUUHIHUUHGWRDV³$FW´ to restore and promote commercial and other business activity within those districts. WHEREAS, Board is authorized pursuant to O.G.G.A. §36-30- RI WKH $FW ³WR provide supplemental services or contract with non- SURILWRUJDQL]DWLRQV´WRHIIHFWWKHSXUSRVHRI the Act in Augusta, Georgia. WHEREAS, Board is also authorized by law, pursuant to O.C.G.A. §36-60-14, to enter into agreements for one year or less with private non-profit organizations in accordance with §§501(c)(3) and 501(c)(6) of the Internal Revenue Code, for the purpose of increasing trade, industry, or new business into the county, or the improvement of general welfare of the county; WHEREAS, Board has recognized the importance of the mission of the CADI; WHEREAS, CADI is a non-profit organization with 501(c)(6) status with the Internal Revenue Service; WHEREAS FURTHER, CADI has entered into a construction project with financial commitments, which necessitates a source of revenue to meet these commitments to complete this project and ARC is willing to provide such revenues as herein specified for CADI; and WHEREAS FURTHER, Board desires to assist CADI by advancing monies with a security interest in this endeavor; NOW, THEREFORE, in consideration of their mutual covenants and within the limitations of this Agreement, Board and CADI hereby agree that: SECTION I Board covenants and agrees to advance an aggregate principal amount of two hundred ninety-one thousand six hundred dollars ($291,600), to bear zero percent (0%) interest per annum, and CADI covenants and agrees to pledge tax revenues which will be collected in December of 2009 as security for payment the advance. Attachment number 1Page 1 of 6 2 a. DURATION This Agreement shall commence on the date of the delivery of the funds to CADI, and shall be in effect until 11:59 p.m. on December 31, 2009 when the anticipated revenue from the special tax is anticipated; however, CADI has the option to extend the Agreement for up to thirty days. Such option must be exercised in writing no more than thirty (30) days prior to the termination date of the Agreement. b. FUNDING SOURCE The Board shall issue payment to be made from funds derived from its general funds or any other funds lawfully available to it for such purposes to provide monies sufficient to fulfill its obligation. c. SECURITY INTEREST In order to assure that the ARC will acquire payment from CADI, the parties hereby agree that there is hereby a superior lien created on the tax revenues that will be received by CADI in December of 2009. d. LEGISLATIVE MODIFICATION Notwithstanding any other provision of this Agreement to the contrary, in the event that any federal, state, or local law, rule, regulation, or interpretation thereof, restricts, prohibits, or in any way materially changes the method or amount of reimbursement or payment for services under this Agreement any time during the Term of this Agreement, then this Agreement shall, to the extent permitted by the laws of Georgia, be deemed amended by the parties to provide for payment of compensation and other fees in a manner consistent with any such prohibition, restriction, or limitation. e. INDEMNIFICATION CADI hereby waives, releases, relinquishes, discharges and agrees to indemnify, protect and hold harmless the ARC and the Board, and their respective employees, agents, partners, representative, directors, servants, attorneys, predecessors, successors, DQG DVVLJQV KHUHLQDIWHU UHIHUUHG WR DV WKH ³,QGHPQLWHHV´ IURP DQ\ DQG DOO FODLPV demands, liabilities loss, costs, and/or expenses for any loss or damage, including but not limited to bodily injury, personal injury, death, property damage, libel, slander, defamation and/or invasion of privacy arising out of CADI¶VSHUIRUPDQFHXQGHUWKLV Agreement as a result of any act of omission, whether intentional or negligent on the part of CADI¶VHPSOR\HHVor agents, or as a result of the application or violation of any pertinent federal, state or local law, rule or regulation by CADI¶VHPSOR\HHV or agents. Attachment number 1Page 2 of 6 3 This indemnification applies notwithstanding the fact that third parties or the Indemnitees may be partially responsible for the situation resulting in the claim or the claim results in a monetary obligation that exceeds any contractual commitment. This indemnification extends to the successors and assigns of CADI, and survives the termination of the Agreement, and to the extent, allowed by law, the bankruptcy of CADI. This indemnification does not apply if the claim arises from the willful and wanton misconduct or sole negligence of the Indemnitees. If, and to the extent such damage or loss as covered in this indemnification is covered by the State Tort Claims Fund established and maintained by the Department of Administrative Services, CADI agrees to reimburse any and all amounts paid out by the State Tort Claims Fund. To the full extent permitted by the Constitution and the laws of the State of Georgia and the terms of the State Tort Claims Fund, CADI and its insurers waive any right of subrogation against the Indemnitees and insurers participating thereunder. CADI shall, at its expense, be entitled to, and shall have the duty to participate in the defense of any suit against the Indemnitees. No settlement or compromise of any claim, loss, or damage entered into by the Indemnitees shall be binding upon CADI unless approved in writing by CADI. No settlement or compromise of any claim, loss, or damage entered into by CADI shall be binding upon the Indemnitees unless approved in writing by the Indemnitees. f. TERMINATION The Board may, in its sole discretion, determine that CADI is failing to substantially comply with the terms and conditions of this Agreement. The Board shall provide written notice thereof to CADI. The notice must identify specific incidents or circumstances comprising the failure of performance. As soon as is practicable, but no more than five (5) business days after receipt of said notice, the appropriate representative of both parties shall meet to discuss the complaint. In the event the complaint is not resolved within the amount of time mutually agreed upon by both parties, the Board may terminate this Agreement upon three (3) calendar days written notice to CADI. CADI shall refund to ARC the previously paid monies pro rata from the date of termination for unearned services. This Agreement may be terminated immediately in the event that any of the following occurs: CADI becomes insolvent or liquidation or dissolution of CADI is initiated; a voluntary or involuntary bankruptcy petition is filed by or against CADI under the United States Bankruptcy Code or any similar petition under any state insolvency law; an assignment is made by CADI for the benefit of creditors; a proceeding for the appointment of a receiver, custodian, trustee, or similar agent is initiated with respect to CADI. Attachment number 1Page 3 of 6 4 Either party may terminate this Agreement by providing thirty (30) days written notice to the non-terminating party. CADI shall refund to ARC the previously paid monies for unearned services. g. AGENCY Neither Party becomes the agent of the other under this Agreement, and each will continue to perform its statutory functions and the functions transferred or retained under this Agreement at its own, sole cost and responsibility, independently of the other. Neither party will be responsible for the contracts, nor other obligations of the other except as specifically stated and transferred hereinabove. h. SEVERABILITY If any term or provision in this Agreement shall be deemed illegal or unenforceable; then, notwithstanding the offending terms or provisions, this Agreement shall remain in full force in effect and such terms or provisions shall be deemed stricken. i. ASSIGNMENT Neither Board nor CADI shall assign its respective obligations arising out of this Agreement, without the prior written consent of the other party. j. WAIVER The waiver by either party of any breach of any provision contained in this Agreement shall not be deemed to be a waiver of such provision on any subsequent breach of the same or any other provision contained in this Agreement. k. OTHER PROVISIONS During the performance of this Agreement, the parties agree to abide by the terms of Executive Order 11246 on nondiscrimination and will not discriminate against any person because of race, color, religion, sex or national origin. The participants will take affirmative action to ensure that applicants are employed without regard to their race, color, religion, or national origin. No member of or delegate to Congress, or resident Commissioner, shall be admitted to any share or part of this Agreement or any benefit that may arise therefrom; but this Attachment number 1Page 4 of 6 5 provision shall not be construed to extend to this Agreement if made with a corporation for its general benefit. The parties agree that any contracts developed and awarded pursuant to this Agreement and all work and procedures related to said contracts, shall, at all times, conform to the applicable federal and state laws, rules, regulations, orders and approvals, including specifically, procedures and requirements relating to labor standards, equal employment opportunity, nondiscrimination, compliance with Americans with Disabilities Act, anti-solicitation, information, and auditing and reporting provisions. l. GOVERNING LAW This Agreement shall be construed in accordance with, and governed by, the laws of the State of Georgia, and jurisdiction shall lie in the Superior Court of Richmond County. m. COMPLETE AGREEMENT This Agreement sets forth all provisions and understandings between the parties. There are no provisions, understandings, representations, or inducements, either oral or written, between the parties other than those hereinabove set forth. It is further understood and agreed that no subsequent alteration, amendment, modification, change or addition to this Agreement shall be binding upon the parties hereto unless the same is reduced to writing and signed by the parties to this Agreement. 23. NOTICE All notices under this Agreement shall be deemed duly given upon delivery, if delivered by certified mail to the party at the addresses set forth below: Fred Russell Robert Kuhar ARC-County Administrator CADI President 530 Green Street, Suite 806 416 Eighth Street Augusta, Georgia 30901 Augusta, Georgia 30901 24. REPRESENTATION AND WARRANTY EACH PARTY HERETO REPRESENTS AND WARRANTS TO THE OTHER THAT: (A) THE EXECUTION AND DELIVERY OF THIS AGREEMENT AND THE PERFORMANCE OF ITS OBLIGATION HEREUNDER BY SUCH PARTY HAVE BEEN DULY AUTHORIZED, AND THAT THE AGREEMENT IS A VALID AND LEGAL AGREEMENT BINDING ON SUCH PARTY AND ENFORCEABLE IN ACCORDANCE WITH ITS TERMS; AND (B) THE EXECUTION AND DELIVERY Attachment number 1Page 5 of 6 6 OF THIS AGREEMENT AND THE PERFORMANCE OF ITS OBLIGATIONS HEREUNDER BY SUCH PARTY DOES NOT AND WILL NOT CONFLICT WITH, OR RESULT IN, BREACH OF ANY AGREEMENT, INDENTURE, OR OTHER INSTRUMENT BINDING ON SUCH PARTY. IN WITNESS WHEREOF, this Agreement is executed as the date first written above. Augusta-Richmond County Clean Augusta Downtown Initiative, Inc. By:___________________________ By:___________________________ Name: David S. Copenhaver Name: Robert Kuhar Title: Mayor Title: President Attest: __________________________ Attest:________________________ Lena Bonner, Clerk of Commission Sanford Loyd, Treasurer [SEAL] [SEAL] Attachment number 1Page 6 of 6 Commission Meeting Agenda 3/17/2009 12:00 PM Contract Extension for TMA Department:Board of Assessors - Charles F. Smith, Chairman and Calvin Hicks, Chief Appraiser Caption:Motion to approve request for extension of TMA Contract. (Approved by Finance Committee March 9, 2009) Background:See attachment Analysis:See attachment Financial Impact:See attachment Alternatives:See attachment Recommendation:Approval Funds are Available in the Following Accounts: Management Consultants - 5211110 REVIEWED AND APPROVED BY: Finance. Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 8 Attachment number 1Page 2 of 8 Attachment number 1Page 3 of 8 Attachment number 1Page 4 of 8 Attachment number 1Page 5 of 8 Attachment number 1Page 6 of 8 Attachment number 1Page 7 of 8 Attachment number 1Page 8 of 8 Commission Meeting Agenda 3/17/2009 12:00 PM Janet Trail Department:Clerk of Commission Caption:Motion to approve the recommendation of the Tax Assessor regarding a request from Ms. Janet Trail for a partial refund of taxes for the years of 2006 through 2008 on property located at 1502 Gordon Highway. (Approved by Finance Committee March 9, 2009) Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Attachment number 1Page 1 of 8 Attachment number 1Page 2 of 8 Attachment number 1Page 3 of 8 Attachment number 1Page 4 of 8 Attachment number 1Page 5 of 8 Attachment number 1Page 6 of 8 Attachment number 1Page 7 of 8 Attachment number 1Page 8 of 8 Attachment number 2Page 1 of 2 Attachment number 2Page 2 of 2 Commission Meeting Agenda 3/17/2009 12:00 PM Renewal Excess Workers Compensation Insurance Department:Finance/Risk Management Caption:Motion to approve Excess Worker’s Compensation Insurance with Safety National Casualty Insurance with Statutory Limits and a $600,000 SIR (self insured retention; otherwise, known as the deductible) for a deposit premium of $164,848. (Approved by Finance Committee March 9, 2009) Background:Excess Workers Compensation coverage (a per occurrence policy) has been purchased in the past as a measure to cap any potential catastrophic loss against Augusta-Richmond County. Knowing that this area of the industry is still quite volatile and premiums continue to rise, Georgia Administrative Services (G.A.S.) Augsuta's W.C. Third Party Administrator, was asked to obtain quotes from at least 3 insurance companies. G.A.S. has received the responses from A or A+ companies and an overview is attached. Analysis:G.A.S. received the following quotes: 1. Safety National Casualty a. Statutory Limit w/$600,000 SIR for a deposit premium of $164,848 b. $ 25,000,000 Limit w/$600,000 SIR for a deposit premium of $150,419 2. Midwest Employer Casualty a. Statutory Limit w/$600,000 SIR for deposit premium of $249,913 b. Statutory Limit w/$750,000 SIR for deposit premium of $199,836 c. Statutory Limit w/$850,000 SIR for deposit premium of $174,184 3. New York Marine & General Insurance a. Statutory Limit w/$600,000 SIR deposit premium of $245,242 Financial Impact:Augusta would assume all financial responsibility up to the SIR limit of $600,000 for each occurrence if this coverage is continued. Alternatives:Drop coverage accepting full exposure/cost of any catastrophic injury. Recommendation:Approve coverage with Safety National Casualty Insurance company with a Self Insured retention of $600,000 with Statutory Limits for a deposit premium of $164,848. Funds are Available in the Following Accounts: 621 01 5233 REVIEWED AND APPROVED BY:Cover Memo Finance. Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Attachment number 1Page 1 of 1 Commission Meeting Agenda 3/17/2009 12:00 PM AJC - GA Power Site Lighting Department:Public Services Department - Facilities Management Division Caption:Motion to authorize Georgia Power Company to proceed with procurement process, underground rough-in and timely installation of parking lot site lighting in the amount of $123,033.00 which includes trenching, underground conduit, wiring, installation of decorative poles and lights for the new Judicial Center. (Approved by Engineering Services Committee March 9, 2009) Background:Georgia Power was selected through negotiations and independent estimate comparison. Heery International and Turner Associates with their consultants have attended meetings, held discussions and corresponded with Georgia Power over the past 9 months working out details for a parking lot lighting installation that will complement the new Judicial Center. Analysis:Georgia Power was found to have provided the least expensive turn-key operation for installing and maintaining the exterior parking lot lighting at the new facility. The poles and lights will coordinate with the existing streetscape lighting in the downtown area. The Scope of Work includes trenching, underground conduit, cable, direct power wiring to Georgia Power line, decorative poles and light installation and is within the budgeted amount that was estimated for this phase of the work. Financial Impact:The amount for upfront costs for the parking lot site lighting is $123,033.00. The Georgia Power package includes a government monthly rate fee for energy and lifetime maintenance warranty of the total installation for $908.42. Alternatives:1. Provide authorization to Georgia Power Company to proceed with procurement process, underground rough-in and timely installation of parking lot site lighting, in the amount of $123,033.00 which includes trenching, underground conduit, wiring, installation of decorative poles and lights for the new Judicial Center. 2. Award to the alternate estimate for $223,182.00 and receive only a one year warranty on the site lighting. Recommendation:#1. Provide authorization to Georgia Power Company to proceed with procurement process, underground rough-in and timely installation of parking lot site lighting, in the amount of $123,033.00 which includes trenching, underground conduit, wiring, installation of decorative poles and lights for the new Judicial Center. Funds are Available in Cover Memo the Following Accounts: FUNDS ARE AVAILABLE IN ACCOUNT: Judicial Center: #324-05- 1120/201150500 Judicial Center: 325-05-1120/209251104 REVIEWED AND APPROVED BY: Finance. Procurement. Law. Administrator. Clerk of Commission Cover Memo Commission Meeting Agenda 3/17/2009 12:00 PM AJC Bid Package 4 Department:Public Services Department - Facilities Management Division Caption:Motion to authorize Potts Construction Company to award Bid Package 4, in the amount of $16,181,872.00, which includes Structural Steel, Courtroom Mock-ups, Drywall/Framing/ACT, Window Wash Tie-Backs, Elevators, HVAC, Plumbing, Fire Protection, and Electrical, for the new Judicial Center with a report given by Potts Construction on a periodic basis regarding local business participation in the project. (Approved by Engineering Services Committee March 9, 2009) Background:Potts Construction was selected under RFQ 07-180 as the Judicial Center project’s Construction Manager at Risk. The Design team, led by Turner Associates, completed the 80% Documents in December, and bids were accepted and reviewed by Potts, under the observation of the Procurement Department. Analysis:The following are the lowest responsive, responsible bidders, as determined by Potts Construction to perform the work. The Subcontractors pursuant to this Exhibit B-4 are as follows: 1. Structural Steel: Jonquil Steel – Mableton, Ga. 2. Courtroom Mockup: Augusta Sash and Door – Augusta, Ga. 3. Elevator: Otis Elevator – Atlanta, Ga. 4. Plumbing/HVAC: Gold Mechanical – Augusta, Ga. 5. Electrical: Dean Electric / Vastec Group – Augusta, Ga. 6. Drywall/ACT: Hester Drywall – Columbia , SC The Scope of Work includes Structural Steel, Courtroom Mock-ups, Drywall/Framing/ACT, Window Wash Tie-Backs, Elevators, HVAC, Plumbing, Fire Protection, and Electrical , and is within the budgeted amount that was estimated for this phase of the work. Potts Construction, in conjunction with the Design and Program Management team, will provide oversight during this and subsequent phases of the project. Proceeding with this work now will allow construction to proceed in an expedited fashion, leading to quicker completion of the new Judicial Center. Potts Construction has included attachment ‘F’ with a unit cost list for site work conditions which was inadvertently not included in B-1 package. Financial Impact:The amount for Bid Package #4 is a component of the Guaranteed Maximum Price (GMP), which is scheduled to be established and approved in March, 2009. The total GMP is currently budgeted to not exceed $48.5M. Alternatives:1. Provide authorization to Potts Construction Company to award Bid Package 4, in the amount of $16,181,872.00, which includes Structural Steel, Courtroom Mock-ups, Drywall/Framing/ACT, Window Wash Tie- Backs, Elevators, HVAC, Plumbing, Fire Protection, and Electrical, for the new Judicial Center. 2. Wait until the Guaranteed Maximum Price is Cover Memo established in March 2009, and delay the completion of the facility by three (3) months. Recommendation:#1. Provide authorization to Potts Construction Company to award Bid Package 4, in the amount of $16,181,872.00, which includes Structural Steel, Courtroom Mock-ups, Drywall/Framing/ACT, Window Wash Tie- Backs, Elevators, HVAC, Plumbing, Fire Protection, and Electrical, for the new Judicial Center. Funds are Available in the Following Accounts: FUNDS ARE AVAILABLE IN ACCOUNT: Judicial Center: #324-05- 1120/201150500 Judicial Center: #325-05-1120/209251104 REVIEWED AND APPROVED BY: Finance. Procurement. Law. Administrator. Clerk of Commission Cover Memo 1 of 1 Exhibit B-4 Authorization for Construction Pursuant to this agreement, the Owner and the Construction Manager hereby execute this Exhibit B-4 and further agree as follows: 1. The Construction Manager’s Guaranteed Maximum Price (“GMP”) proposal for the entire Project has not been established. However, the Construction Manager's GMP for the Early Award Bid Package #4, dated February 20, 2009, to fast track the Project, attached hereto and incorporated herein, is accepted by the Owner. Construction Manager’s GMP for the early award bid packages #1, 2, and 3 to fast track the project, have been accepted by the Owner as per the executed exhibit B-1, 2, and 3. 2. The General Conditions Guaranteed Maximum Cost for the Project, as per Executed Exhibit B-1, is $3,004,130.00 3. Preconstruction Services Cost, as per Executed Exhibit B-1, is $192,455.00 4. The Subcontracts Cost is: Bid Package #1, as per Executed Exhibit B-1 Bid Package #2, as per Executed Exhibit B-2 Bid Package #3, as per Executed Exhibit B-3 Bid Package #4 Change Order #1 Bid Package #5 $1,610,762.00 $877,884.00 $7,102,179.00 $16,181,872.00 $16,578.00 TBD 5. The Lump Sum Fixed Management Fee for the Project, as per Executed Exhibit B-1, is $1,798,026.00 6. The Guaranteed Maximum Price for the Project is TBD 7. The Date of Substantial Completion shall be TBD Exhibit B-4 is based on attached Schedule “A” dated February 20, 2009. Owner: Construction Manager: Augusta, Georgia The Potts Company By: (Signature) (Seal) (Signature) (Seal) David C. Buser (Name) (Name) President (Title) (Title) 981 East Freeway Drive (Attest) (Street Address – No PO Box) Conyers, Georgia 30094 (City Clerk) (City, State, Zip) Date of Signature Date of Signature Attachment number 1Page 1 of 57 Augusta Augusta Augusta Page 1 of 4 AJC - Bid Package 04 2/20/2009 11:09 AM Schedule "A" Attachment "A" Augusta-Richmond County Judicial Center - 35 Bid Package 04 - Critical Path Project name AJC - Bid Package 04 Schedule "A" Attachment "A" Augusta GA Estimator GRL/JGS/JCB/SWH Bid date 2/20/2008 5:00 PM Report format Sorted by 'Group phase/Phase' 'Detail' summary Allocate addons Print item notes Attachment number 1Page 5 of 57 Page 2 of 4 AJC - Bid Package 04 2/20/2009 11:09 AM Schedule "A" Attachment "A" Item Description Takeoff Qty Labor Unit Cost Amount Material Unit Cost Amount Subcontract Unit Cost Amount Name Total Unit Cost Amount 05000.0 METALS 05120.0 Structural Steel 01 Bid Package 04 - Structural and Miscellaneous Steel Subcontractor 1.00 lsum - -- -509,404.00 /lsum 509,404 509,404.00 /lsum 509,404 Structural Steel 182,668.00 sqft 2.79 /sqft 509,404 2.79 /sqft 509,404 METALS 182,668.00 sqft 0 0 2.79 /sqft 509,404 2.79 /sqft 509,404 06000.0 WOOD AND PLASTICS 06220.0 Millwork ----Bid Package 04 - Courtroom Mock up Subcontractor 1.00 lsum 22,601.00 /lsum 22,601 22,601.00 /lsum 22,601 Millwork 182,668.00 sqft 0.124/sqft 22,601 0.124/sqft 22,601 WOOD AND PLASTICS 182,668.00 sqft 0 0 0.124/sqft 22,601 0.124/sqft 22,601 09000.0 FINISHES 09250.0 Gypsum Wallboard 01 Bid Package 04 - Drywall / LG Metal Framing / ACT Subcontractor 1.00 lsum - -- -3,452,393.00 /lsum 3,452,393 3,452,393.00 /lsum 3,452,393 Gypsum Wallboard 182,668.00 sqft 18.90 /sqft 3,452,393 18.90 /sqft 3,452,393 FINISHES 182,668.00 sqft 0 0 18.90 /sqft 3,452,393 18.90 /sqft 3,452,393 13000.0 SPECIAL CONSTRUCTION 13120.0 Division 13 Subcontractor ----Bid Package 04 - Window Washing Tie Backs Subcontractor 1.00 lsum 27,374.00 /lsum 27,374 27,374.00 /lsum 27,374 Changed to include only four story in 07-29-08 Reconciliation Meeting at the request of the Design Team and Owner. Division 13 Subcontractor 182,668.00 sqft 0.15 /sqft 27,374 0.15 /sqft 27,374 SPECIAL CONSTRUCTION 182,668.00 sqft 0 0 0.15 /sqft 27,374 0.15 /sqft 27,374 14000.0 CONVEYING SYSTEMS 14200.0 Elevators 02 Bid Package 04 - Elevator Subcontractor 1.00 lsum - -- -791,900.00 /lsum 791,900 791,900.00 /lsum 791,900 Elevators 182,668.00 sqft 4.34 /sqft 791,900 4.34 /sqft 791,900 Attachment number 1Page 6 of 57 Page 3 of 4 AJC - Bid Package 04 2/20/2009 11:09 AM Schedule "A" Attachment "A" Item Description Takeoff Qty Labor Unit Cost Amount Material Unit Cost Amount Subcontract Unit Cost Amount Name Total Unit Cost Amount CONVEYING SYSTEMS 182,668.00 sqft 0 0 4.34 /sqft 791,900 4.34 /sqft 791,900 15000.0 MECHANICAL 15300.0 Fire Protection 01 Bid Package 04 - Fire Protection Subcontractor 1.00 lsum - -- -431,300.00 /lsum 431,300 431,300.00 /lsum 431,300 Fire Protection 182,668.00 sqft 2.361/sqft 431,300 2.361/sqft 431,300 15400.0 Plumbing 01 Bid Package 04 - Plumbing Subcontractor 0.00 lsum - -- -0.00 0 Included in HVAC / Plumbing Subcontractor, see section 15500.0 15500.0 HVAC 01 Bid Package 04 - HVAC / Plumbing Subcontractor 1.00 lsum - -- -5,001,338.00 /lsum 5,001,338 5,001,338.00 /lsum 5,001,338 HVAC 182,668.00 sqft 27.38 /sqft 5,001,338 27.38 /sqft 5,001,338 MECHANICAL 182,668.00 sqft 0 0 29.741/sqft 5,432,638 29.741/sqft 5,432,638 16000.0 ELECTRICAL 16010.0 Electrical Subcontractor 02 Bid Package 04 - Electrical Subcontractor 1.00 lsum - -- -5,241,329.00 /lsum 5,241,329 5,241,329.00 /lsum 5,241,329 Electrical Subcontractor 182,668.00 sqft 28.693/sqft 5,241,329 28.693/sqft 5,241,329 ELECTRICAL 182,668.00 sqft 0 0 28.693/sqft 5,241,329 28.693/sqft 5,241,329 Attachment number 1Page 7 of 57 Page 4 of 4 AJC - Bid Package 04 2/20/2009 11:09 AM Schedule "A" Attachment "A" Estimate Totals Description Amount Totals Hours Rate Cost Basis Cost per Unit Labor Material Subcontract 15,477,639 Equipment Other 15,477,639 15,477,639 Sub Bonds 309,553 2.000 %C 309,553 15,787,192 CM/GC Contingency 394,680 2.500 %T 394,680 16,181,872 Total 16,181,872 Attachment number 1Page 8 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST A0.0 COVER 12-22-08 02-10-09 FEB 10 2009 A0.1 DRAWING INDEX 12-22-08 02-10-09 FEB 10 2009 A0.2 NOTES SYMBOLS & ABBREVIATIONS 12-22-08 DEC 22 2008 C-0 CIVIL COVER SHEET DECEMBER 22, 2008 DEC 22 2008 C-1 EXISTING CONDITIONS & DEMOLITION PLAN DECEMBER 22, 2008 DEC 22 2008 C-2 GRADING & DRAINAGE PLAN DECEMBER 22, 2008 DEC 22 2008 C-3 UTILITY PLAN DECEMBER 22, 2008 02-10-09 FEB 10 2009 C-4 STAKING & PAVING PLAN DECEMBER 22, 2008 DEC 22 2008 C-5 STORM & SANITARY SEWER PROFILES DECEMBER 22, 2008 DEC 22 2008 C-6 INITIAL EROSION CONTROL PLAN DECEMBER 22, 2008 DEC 22 2008 C-7 INTERMEDIATE EROSION CONTROL PLAN DECEMBER 22, 2008 DEC 22 2008 C-8 FINAL EROSION CONTROL PLAN DECEMBER 22, 2008 DEC 22 2008 C-9 STREET & STORM SEWER DETAILS DECEMBER 22, 2008 DEC 22 2008 Project Name: Augusta Richmond County Judicial Center Sht No.s DRAWING NAME GMP ADDENDUM ISSUE DATE GMP DOCUMENTS ISSUE DATE TPC RECV'D STAMP DATE C-10 WATER & SANITARY SEWER DETAILS DECEMBER 22, 2008 DEC 22 2008 C-11 MISCELLANEOUS DETAILS DECEMBER 22, 2008 DEC 22 2008 C-12 NPDES PLAN DECEMBER 22, 2008 DEC 22 2008 C-13 EROSION CONTROL DETAILS DECEMBER 22, 2008 DEC 22 2008 L-1 Tree Planting Plan 12/22/08 DEC 22 2008 L-2 Shrub Planing Plan 12/22/08 DEC 22 2008 L-3 Irrigation Plan 12/22/08 DEC 22 2008 L-4 Landscape and Irrigation Details 12/22/08 DEC 22 2008 A1.1 ARCHITECTURAL SITE PLAN 12-22-08 DEC 22 2008 A1.2 ENLARGED SITE PLAN & DETAILS 12-22-08 02-10-09 FEB 10 2009 A1.3 SITE DETAILS 12-22-08 02-10-09 FEB 10 2009 ALS1.1 FIRST FLOOR LIFE SAFETY PLAN 12-22-08 02-10-09 FEB 10 2009 ALS1.2 SECOND FLOOR LIFE SAFETY PLAN 12-22-08 DEC 22 2008 ALS1.3 THIRD FLOOR LIFE SAFETY PLAN 12-22-08 DEC 22 2008 ALS1.4 FOURTH FLOOR LIFE SAFETY PLAN 12-22-08 DEC 22 2008 A2.1 OVERALL FIRST FLOOR PLAN 12/22/08 DEC 22 2008 A2.2 OVERALL SECOND FLOOR PLAN 12/22/08 DEC 22 2008 A2.3 OVERALL THIRD FLOOR PLAN 12/22/08 DEC 22 2008 A2.4 OVERALL FOURTH FLOOR PLAN 12/22/08 DEC 22 2008 A2.5 OVERALL ROOF PLAN 12-22-08 02-10-09 FEB 10 2009 A2.6 FIRST FLOOR PLAN PART I 12/22/08 2/10/09 FEB 10 2009 Page 1 of 16 Attachment number 1Page 9 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST Project Name: Augusta Richmond County Judicial Center A2.7 FIRST FLOOR PLAN PART II 12/22/08 2/10/09 FEB 10 2009 A2.8 FIRST FLOOR PLAN PART III 12/22/08 2/10/09 FEB 10 2009 A2.9 SECOND FLOOR PLAN PART I 12/22/08 2/10/09 FEB 10 2009 A2.10 SECOND FLOOR PLAN PART II 12/22/08 2/10/09 FEB 10 2009 A2.11 SECOND FLOOR PLAN PART III 12/22/08 2/10/09 FEB 10 2009 A2.12 THIRD FLOOR PLAN PART I 12/22/08 2/10/09 FEB 10 2009 A2.13 THIRD FLOOR PLAN PART II 12/22/08 2/10/09 FEB 10 2009 A2.14 FOURTH FLOOR PLAN PART I 12/22/08 2/10/09 FEB 10 2009 A2.15 FOURTH FLOOR PLAN PART II 12/22/08 2/10/09 FEB 10 2009 A2.16 FIRST FLOOR OVERALL RCP 12/22/08 DEC 22 2008 A2.17 SECOND FLOOR OVERALL RCP 12/22/08 DEC 22 2008 A2.18 THIRD FLOOR OVERALL RCP 12/22/08 DEC 22 2008 A2.19 FOURTH FLOOR OVERALL RCP 12/22/08 DEC 22 2008 A2.20 FIRST FLOOR RCP - PART I 12/22/08 2/10/09 FEB 10 2009 A2.21 FIRST FLOOR RCP - PART II 12/22/08 2/10/09 FEB 10 2009 A2.22 FIRST FLOOR RCP - PART III 12/22/08 2/10/09 FEB 10 2009 A2.23 SECOND FLOOR RCP - PART I 12/22/08 2/10/09 FEB 10 2009 A2.24 SECOND FOOR RCP - PART II 12/22/08 2/10/09 FEB 10 2009 A2.25 SECOND FLOOR RCP - PART III 12/22/08 DEC 22 2008 A2.26 THIRD FLOOR RCP - PART I 12/22/08 2/10/09 FEB 10 2009 A2.27 THIRD FLOOR RCP - PART II 12/22/08 2/10/09 FEB 10 2009 A2.28 FOURTH FLOOR RCP - PART I 12/22/08 2/10/09 FEB 10 2009 A2.29 FOURTH FLOOR RCP - PART II 12/22/08 2/10/09 FEB 10 2009 A2.30 ENLARGED LOBBY PLAN 12/22/08 02-10-09 FEB 10 2009 A.230.1 ENLARGED LOBBY REFLECTED CEILING PLAN 12-22-08 02-10-09 FEB 10 2009 A2.31 LOBBY FLOOR PATTERN PLAN 12-22-08 02-10-09 FEB 10 2009 A2.32 ENLARGED PLAN/RCP - SPECIAL PROCEEDINGS COURTROOM DECEMBER 22nd, 2008 DEC 22 2008 A2.33 ENLARGED PLAN/RCP - LARGE COURTROOM DECEMBER 22nd, 2008 DEC 22 2008 A2.34 ENLARGED PLAN/RCP - STANDARD COURTROOM DECEMBER 22nd, 2008 DEC 22 2008 A2.35 ENLARGED PLAN/RCP - HEARING ROOM & GRAND JURY ROOM DECEMBER 22nd, 2008 DEC 22 2008 A2.36 ENLARGED PLAN/RCP - NON-JURY COURTROOM DECEMBER 22nd, 2008 DEC 22 2008 A2.37 TOILET ROOM PLANS & ELEVATIONS 12/22/08 DEC 22 2008 A2.38 TOILET ROOM PLANS & ELEVATIONS 12/22/08 2/10/09 FEB 10 2009 A2.39 TOILET ROOM PLANS & ELEVATIONS 12/22/08 2/10/09 FEB 10 2009 A2.41 ENLARGED PLANS AND ELEVATIONS - DETENTION AREAS DECEMBER 22nd, 2008 02-10-09 FEB 10 2009 A2.42 ENLARGED PLANS-DETENTION AREAS DECEMBER 22nd, 2008 DEC 22 2008 Page 2 of 16 Attachment number 1Page 10 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST Project Name: Augusta Richmond County Judicial Center A2.42.1 ENLARGED PLANS AND ELEVATIONS - DETENTION AREAS DECEMBER 22nd, 2008 DEC 22 2008 A2.44 TOWER PLANS 12-22-08 02-10-09 FEB 10 2009 A3.1 PARTITION TYPES 11/5/08 2/10/09 FEB 10 2009 A3.2 DOOR SCHEDULE 12/22/08 2/10/09 FEB 10 2009 A3.3 DOOR SCHEDULE 12/22/08 2/10/09 FEB 10 2009 A3.4 DOOR AND FRAME ELEVATIONS 12/22/08 2/10/09 FEB 10 2009 A3.5 INTERIOR DOOR DETAILS 12/22/08 2/10/09 FEB 10 2009 A3.7 INTERIOR WINDOW ELEVATIONS & DETAILS 12/22/08 2/10/09 FEB 10 2009 A3.8 WINDOW & CURTAIN WALL ELEVATIONS 12-22-08 02-10-09 FEB 10 2009 A3.9 FIRST FLOOR FINISH PLAN 12/22/08 2/10/09 FEB 10 2009 A3.10 SECOND FLOOR FINISH PLAN 12/22/08 2/10/09 FEB 10 2009 A3.11 THIRD FLOOR FINISH PLAN 12/22/08 2/10/09 FEB 10 2009 A3.12 FOURTH FLOOR FINISH PLAN 12/22/08 2/10/09 FEB 10 2009 A4.1 EXTERIOR ELEVATIONS 12-22-08 02-10-09 FEB 10 2009 A4.2 EXTERIOR ELEVATIONS 12-22-08 02-10-09 FEB 10 2009 A4.3 ENLARGED ELEVATIONS 12-22-08 02-10-09 FEB 10 2009 A4.4 ENLARGED ELEVATIONS 12-22-08 02-10-09 FEB 10 2009 A4.4.1 ALTERNATE ENLARGED ELEVATIONS @ TOWER 12-22-08 02-10-09 FEB 10 2009 A4.5 BUILDING SECTIONS 12-22-08 DEC 22 2008 A4.6 BUILDING SECTIONS 12-22-08 DEC 22 2008 A4.7 BUILDING SECTIONS 12-22-08 DEC 22 2008 A5.1 WALL SECTIONS 12-22-08 02-10-09 FEB 10 2009 A5.2 WALL SECTIONS 12-22-08 02-10-09 FEB 10 2009 A5.3 WALL SECTIONS 12-22-08 02-10-09 FEB 10 2009 A5.4 WALL SECTIONS 12-22-08 02-10-09 FEB 10 2009 A5.5 WALL AND SECTION DETAILS 12-22-08 02-10-09 FEB 10 2009 A5.6 LOBBY SECTIONS 12-22-08 02-10-09 FEB 10 2009 A5.7 TOWER SECTION 12-22-08 DEC 22 2008 A5.8 TOWER SECTION 12-22-08 DEC 22 2008 A5.9 LOBBY WALL SECTIONS 12-22-08 02-10-09 FEB 10 2009 A6.0 STAIR #1 PLANS & SECTIONS 12-22-08 02-10-09 FEB 10 2009 A6.1 STAIR #1 DETAILS 12-22-08 02-10-09 FEB 10 2009 A6.1.1 STAIR #1 DETAILS 12-22-08 02-10-09 FEB 10 2009 A6.2 STAIR #2 PLANS, SECTIONS & DETAILS 12/22/08 DEC 22 2008 A6.3 STAIR #3 PLANS, SECTIONS & DETAILS 12/22/08 2/10/09 FEB 10 2009 A6.4 STAIR #4 PLANS, SECTIONS & DETAILS 12/22/08 2/10/09 FEB 10 2009 Page 3 of 16 Attachment number 1Page 11 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST Project Name: Augusta Richmond County Judicial Center A6.5 ELEVATOR PLANS 12/22/08 2/10/09 FEB 10 2009 A6.6 ELEVATOR SECTIONS & DETAILS 12/22/08 2/10/09 FEB 10 2009 A7.1 LOBBY 2ND FLOOR ELEVATIONS 12/22/08 DEC 22 2008 A7.2 PUBLIC CORRIDOR ELEVATIONS 12/22/08 2/10/09 FEB 10 2009 A7.2.1 ADD ALTERNATE PUBLIC CORRIDOR ELEVATIONS 12/22/08 2/10/09 FEB 10 2009 A7.3 STAFF CORRIDOR ELEVATIONS 12/22/08 DEC 22 2008 A7.4 INTERIOR PLANS & ELEVATOINS 12/22/08 2/10/09 FEB 10 2009 A7.5 INTERIOR ELEVATIONS-MILLWORK 12/22/08 2/10/09 FEB 10 2009 A7.6 LOBBY INTERIOR ELEVATIONS 12-22-08 02-10-09 FEB 10 2009 A7.6.1 ALTERNATE LOBBY INTERIOR ELEVATIONS 12-22-08 02-10-09 FEB 10 2009 A7.7 LOBBY MILLWORK PLAN & ELEVATIONS 12-22-08 DEC 22 2008 A7.8 INTERIOR ELEVATIONS - COURTROOM DECEMBER 22nd, 2008 DEC 22 2008 A7.9 INTERIOR ELEVATIONS COURTROOMI DECEMBER 22nd, 2008 DEC 22 2008 A7.10 INTERIOR ELEVATIONS - NON-JURY/HEARING ROOM DECEMBER 22nd, 2008 DEC 22 2008 A7.11 INTERIOR ELEVATIONS - GRAND JURY DECEMBER 22nd, 2008 DEC 22 2008 A8.1 INTERIOR PLAN / SECTION DETAILS 12/22/08 2/10/09 FEB 10 2009 A8.4 LOBBY PLAN DETAILS 12-22-08 02-10-09 FEB 10 2009 A8.5 COURTROOM PLAN/SECTION DETAILS DECEMBER 22nd, 2008 DEC 22 2008 A8.5.1 COURTROOM PLAN/SECTION DETAILS DECEMBER 22nd, 2008 DEC 22 2008 A8.6 DETENTION DETAILS DECEMBER 22nd, 2008 DEC 22 2008 A8.7 PLAN DETAILS 12-22-08 02-10-09 FEB 10 2009 A8.8 PLAN DETAILS 12-22-08 02-10-09 FEB 10 2009 A8.9 SECTION DETAILS 12-22-08 02-10-09 FEB 10 2009 A8.10 DETAILS 12-22-08 02-10-09 FEB 10 2009 A8.11 SECTION DETAILS 12-22-08 02-10-09 FEB 10 2009 A8.12 SECTION DETAILS 12-22-08 02-10-09 FEB 10 2009 A8.13 TOWER PLAN DETAILS 12-22-08 02-10-09 FEB 10 2009 A8.14 PLAN DETAILS 12-22-08 02-10-09 FEB 10 2009 A8.15 ROOF DETAILS 12-22-08 02-10-09 FEB 10 2009 A8.16 ROOF DETAILS 12-22-08 02-10-09 FEB 10 2009 A9.1 INTERIOR ELEVATIONS 12-22-08 2-10-09 FEB 10 2009 A9.2 INTERIOR MILLWORK SECTIONS & DETAILS 2/10/09 FEB 10 2009 A9.3 LOBBY MILLWORK SECTIONS & DETAILS 12-22-08 DEC 22 2008 A9.4 SPECIAL PROCEEDINGS COURTROOM MILLWORK ELEVATIONS DECEMBER 22nd, 2008 02-10-09 FEB 10 2009 A9.5 LARGE/STANDARD COURTROOM MILLWORK ELEVATIONS DECEMBER 22nd, 2008 02-10-09 FEB 10 2009 A9.6 COURTROOM MILLWORK ELEVATIONS DECEMBER 22nd, 2008 02-10-09 FEB 10 2009 Page 4 of 16 Attachment number 1Page 12 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST Project Name: Augusta Richmond County Judicial Center A9.7 NON-JURY/HEARING ROOM MILLWORK ELEVATIONS DECEMBER 22nd, 2008 DEC 22 2008 A9.8 COURTROOM MILLWORK DETAILS DECEMBER 22nd, 2008 DEC 22 2008 A9.9 COURTROOM MILLWORK DETAILS DECEMBER 22nd, 2008 DEC 22 2008 A9.10 COURTROOM MILLWORK & DETAILS DECEMBER 22nd, 2008 DEC 22 2008 A9.11 DETENTION MILLWORK. SECTIONS & DETAILS DECEMBER 22nd, 2008 DEC 22 2008 I-111.1 FIRST FLOOR FURNITURE PLAN SECTION 1 12/22/08 DEC 22 2008 I-111.2 FIRST FLOOR FURNITURE PLAN SECTION 2 12/22/08 DEC 22 2008 I-111.3 FIRST FLOOR FURNITURE PLAN SECTION 3 12/22/08 DEC 22 2008 I-112.1 SECOND FLOOR FURNITURE PLAN SECTION 1 12/22/08 DEC 22 2008 I-112.2 SECOND FLOOR FURNITURE PLAN SECTION 2 12/22/08 DEC 22 2008 I-112.3 SECOND FLOOR FURNITURE PLAN SECTION 3 12/22/08 DEC 22 2008 I-113.1 THIRD FLOOR FURNITURE PLAN SECTION 1 12/22/08 DEC 22 2008 I-113.2 THIRD FLOOR FURNITURE PLAN SECTION 2 12/22/08 DEC 22 2008 1-114.1 FOURTH FLOOR FURNITURE PLAN SECTION 1 12/22/08 DEC 22 2008 1-114.2 FOURTH FLOOR FURNITURE PLAN SECTION 2 12/22/08 DEC 22 2008 F0.0 DEEP FOUNDATION GENERAL NOTES 12-22-2008 DEC 22 2008 F1.0 AUGER CAST PILE LAYOUT PLAN OVERALL 12-22-2008 02-10-2009 FEB 10 2009 F1.1 AUGER CAST PILE LAYOUT PLAN 12-22-2008 02-10-2009 FEB 10 2009 F1.2 AUGER CAST PILE LAYOUT PLAN 12-22-2008 DEC 22 2008 F1.3 AUGER CAST PILE LAYOUT PLAN 12-22-2008 02-10-2009 FEB 10 2009 F2.0 PILE FOUNDATION DETAILS 12-22-2008 DEC 22 2008 F2.1 FOUNDATION DETAILS 12-22-2008 DEC 22 2008 S0.0 STRUCTURAL NOTES 12-22-2008 DEC 22 2008 S0.1 STRUCTURAL NOTES & LEGEND 12-22-2008 DEC 22 2008 S0.2 FIRST LEVEL LOADING PLAN 12-22-2008 DEC 22 2008 S0.3 SECOND LEVEL LOADING PLAN 12-22-2008 DEC 22 2008 S0.4 THIRD LEVEL LOADING PLAN 12-22-2008 DEC 22 2008 S0.5 FOURTH LEVEL LOADING PLAN 12-22-2008 DEC 22 2008 S0.6 FIRST LEVEL EDGE OF SLAB PLAN 12-22-2008 DEC 22 2008 S0.7 SECOND LEVEL EDGE OF SLAB PLAN 12-22-2008 DEC 22 2008 S0.8 THIRD LEVEL EDGE OF SLAB PLAN 12-22-2008 DEC 22 2008 S0.9 FOURTH LEVEL EDGE OF SLAB PLAN 12-22-2008 DEC 22 2008 S0.10 FIFTH LEVEL EDGE OF SLAB PLAN 12-22-2008 DEC 22 2008 S1.0 PILE CAP LAYOUT PLAN OVERALL 12-22-2008 02-10-2009 FEB 10 2009 S1.1 PILE CAP LAYOUT PLAN 12-22-2008 02-10-2009 FEB 10 2009 S1.2 PILE CAP LAYOUT PLAN 12-22-2008 DEC 22 2008 Page 5 of 16 Attachment number 1Page 13 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST Project Name: Augusta Richmond County Judicial Center S1.3 PILE CAP LAYOUT PLAN 12-22-2008 02-10-2009 FEB 10 2009 S1.4 FIRST LEVEL SLAB & GRADE BEAM LAYOUT PLAN OVERALL 12-22-2008 DEC 22 2008 S1.5 FIRST LEVEL SLAB & GRADE BEAM LAYOUT PLAN 12-22-2008 DEC 22 2008 S1.6 FIRST LEVEL SLAB & GRADE BEAM LAYOUT PLAN 12-22-2008 DEC 22 2008 S1.7 FIRST LEVEL SLAB & GRADE BEAM LAYOUT PLAN 12-22-2008 DEC 22 2008 S2.0 SECOND LEVEL FRAMIING PLAN OVERALL 12-22-2008 DEC 22 2008 S2.1 SECOND LEVEL FRAMING PLAN 12-22-2008 DEC 22 2008 S2.2 SECOND LEVEL FRAMING PLAN 12-22-2008 DEC 22 2008 S2.3 SECOND LEVEL FRAMING PLAN 12-22-2008 DEC 22 2008 S2.4 SECOND LEVEL SLAB PLAN 12-22-2008 DEC 22 2008 S2.5 SECOND LEVEL SLAB PLAN 12-22-2008 DEC 22 2008 S2.6 SECOND LEVEL SLAB PLAN 12-22-2008 DEC 22 2008 S2.7 SECOND LEVEL SLAB PLAN 12-22-2008 DEC 22 2008 S3.0 THIRD LEVEL FRAMING PLAN OVERALL 12-22-2008 DEC 22 2008 S3.1 THIRD LEVEL FRAMING PLAN 12-22-2008 DEC 22 2008 S3.2 THIRD LEVEL FRAMING PLAN 12-22-2008 DEC 22 2008 S3.3 THIRD LEVEL FRAMING PLAN 12-22-2008 DEC 22 2008 S3.4 THIRD LEVEL SLAB PLAN OVERALL 12-22-2008 DEC 22 2008 S3.5 THIRD LEVEL SLAB PLAN 12-22-2008 DEC 22 2008 S3.6 THIRD LEVEL SLAB PLAN 12-22-2008 DEC 22 2008 S3.7 THIRD LEVEL SLAB PLAN 12-22-2008 DEC 22 2008 S4.0 FOURTH LEVEL FRAMING PLAN OVERALL 12-22-2008 DEC 22 2008 S4.1 FOURTH LEVEL FRAMING PLAN 12-22-2008 DEC 22 2008 S4.2 FOURTH LEVEL FRAMING PLAN 12-22-2008 DEC 22 2008 S4.3 FOURTH LEVEL SLAB PLAN OVERALL 12-22-2008 DEC 22 2008 S4.4 FOURTH LEVEL SLAB PLAN 12-22-2008 DEC 22 2008 S4.5 FOURTH LEVEL SLAB PLAN 12-22-2008 DEC 22 2008 S5.0 FIFTH LEVEL FRAMING PLAN OVERALL 12-22-2008 DEC 22 2008 S5.1 FIFTH LEVEL FRAMING PLAN 12-22-2008 DEC 22 2008 S5.2 FIFTH LEVEL FRAMING PLAN 12-22-2008 DEC 22 2008 S5.3 FIFTH LEVEL SLAB PLAN OVERALL 12-22-2008 DEC 22 2008 S5.4 FIFTH LEVEL SLAB PLAN 12-22-2008 DEC 22 2008 S5.5 FIFTH LEVEL SLAB PLAN 12-22-2008 DEC 22 2008 S6.0 TOWER FRAMING PLAN 12-22-2008 DEC 22 2008 S7.0 BEAM SCHEDULE AND DETAILS 12-22-2008 DEC 22 2008 S7.1 BEAM SCHEDULE AND DETAILS 12-22-2008 02-10-2009 FEB 10 2009 Page 6 of 16 Attachment number 1Page 14 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST Project Name: Augusta Richmond County Judicial Center S7.2 BEAM SCHEDULE AND DETAILS 12-22-2008 DEC 22 2008 S7.3 BEAM SCHEDULE AND DETAILS 12-22-2008 DEC 22 2008 S7.4 BEAM SCHEDULE AND DETAILS 12-22-2008 DEC 22 2008 S7.5 BEAM SCHEDULE AND DETAILS 12-22-2008 DEC 22 2008 S7.6 BEAM SCHEDULE AND DETAILS 12-22-2008 DEC 22 2008 S7.7 BEAM SCHEDULE AND DETAILS 12-22-2008 DEC 22 2008 S7.8 COLUMN SCHEDULE AND DETAILS 12-22-2008 DEC 22 2008 S7.9 COLUMN SCHEDULE AND DETAILS 12-22-2008 DEC 22 2008 S8.0 FOUNDATION DETAILS 12-22-2008 DEC 22 2008 S8.1 FOUNDATION DETAILS 12-22-2008 DEC 22 2008 S9.0 MASONRY SECTIONS & DETAILS 12-22-2008 DEC 22 2008 S10.0 STEEL SECTIONS & DETAILS 12-22-2008 DEC 22 2008 S11.0 CONCRETE FRAME SECTIONS & DETAILS 12-22-2008 DEC 22 2008 S11.1 CONCRETE FRAME SECTIONS & DETAILS 12-22-2008 DEC 22 2008 S11.2 CONCRETE FRAME SECTIONS & DETAILS 12-22-2008 DEC 22 2008 S11.3 CONCRETE FRAME SECTIONS & DETAILS 12-22-2008 DEC 22 2008 S11.4 CONCRETE FRAME SECTIONS & DETAILS 12-22-2008 DEC 22 2008 S11.5 CONCRETE FRAME SECTIONS & DETAILS 12-22-2008 DEC 22 2008 S12.0 ELEVATOR PLANS, DETAILS & SECTIONS 12-22-2008 DEC 22 2008 S13.0 STAIR PLANS, DETAILS & SECTIONS 12-22-2008 DEC 22 2008 A0.0 COVER 12-22-08 02-10-09 FEB 10 2009 A0.1 DRAWING INDEX 12-22-08 02-10-09 FEB 10 2009 M-101.1 HVAC PLAN - FIRST FLOOR - PART I 12/22/2008 02/10/2009 FEB 10 2009 M-101.2 HVAC PLAN - FIRST FLOOR - PART II 12/22/2008 02/10/2009 FEB 10 2009 M-101.3 HVAC PLAN - FIRST FLOOR - PART III 12/22/2008 02/10/2009 FEB 10 2009 M-102.1 HVAC PLAN - SECOND FLOOR - PART I 12/22/2008 02/10/2009 FEB 10 2009 M-102.2 HVAC PLAN - SECOND FLOOR - PART II 12/22/2008 02/10/2009 FEB 10 2009 M-102.3 HVAC PLAN - SECOND FLOOR - PART III 12/22/2008 02/10/2009 FEB 10 2009 M-103.1 HVAC PLAN - THIRD FLOOR - PART I 12/22/2008 02/10/2009 FEB 10 2009 M-103.2 HVAC PLAN - THIRD FLOOR - PART II 12/22/2008 02/10/2009 FEB 10 2009 M-103.3 HVAC PLAN - SECOND FLOOR ROOF 12/22/2008 02/10/2009 FEB 10 2009 M-104.1 HVAC PLAN - FOURTH FLOOR- PART I 12/22/2008 02/10/2009 FEB 10 2009 M-104.2 HVAC PLAN - FOURTH FLOOR- PART II 12/22/2008 02/10/2009 FEB 10 2009 M-105.1 HVAC PLAN - FOURTH FLOOR ROOF - PART I 12/22/2008 02/10/2009 FEB 10 2009 M-105.2 HVAC PLAN - FOURTH FLOOR ROOF - PART II 12/22/2008 02/10/2009 FEB 10 2009 M-301 HVAC LEGEND & DETAILS 12/22/2008 02/10/2009 FEB 10 2009 Page 7 of 16 Attachment number 1Page 15 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST Project Name: Augusta Richmond County Judicial Center M-302 HVAC DETAILS 12/22/2008 02/10/2009 FEB 10 2009 M-303 HVAC CONTROLS 12/22/2008 02/10/2009 FEB 10 2009 M-401 HVAC SCHEDULES 12/22/2008 02/10/2009 FEB 10 2009 M-402 HVAC SCHEDULES 12/22/2008 02/10/2009 FEB 10 2009 M-403 HVAC SCHEDULES 12/22/2008 02/10/2009 FEB 10 2009 P-101.1 PLUMBING WASTE PLAN - BELOW FIRST FLOOR - PART 1 12/22/2008 02/10/2009 FEB 10 2009 P-101.2 PLUMBING WASTE PLAN - BELOW FIRST FLOOR - PART 2 12/22/2008 02/10/2009 FEB 10 2009 P-101.3 PLUMBING WASTE PLAN - BELOW FIRST FLOOR - PART 3 12/22/2008 02/10/2009 FEB 10 2009 P-102.1 PLUMBING WASTE PLAN - ABOVE FIRST FLOOR - PART 1 12/22/2008 02/10/2009 FEB 10 2009 P-102.2 PLUMBING WASTE PLAN - ABOVE FIRST FLOOR - PART 2 12/22/2008 02/10/2009 FEB 10 2009 P-102.3 PLUMBING WASTE PLAN - ABOVE FIRST FLOOR - PART 3 12/22/2008 02/10/2009 FEB 10 2009 P-102.4 PLUMBING WATER PLAN - ABOVE FIRST FLOOR - PART 1 12/22/2008 02/10/2009 FEB 10 2009 P-102.5 PLUMBING WATER PLAN - ABOVE FIRST FLOOR - PART 2 12/22/2008 02/10/2009 FEB 10 2009 P-102.6 PLUMBING WATER PLAN - ABOVE FIRST FLOOR - PART 3 12/22/2008 02/10/2009 FEB 10 2009 P-103.1 PLUMBING WASTE PLAN - ABOVE SECOND FLOOR - PART 1 12/22/2008 02/10/2009 FEB 10 2009 P-103.2 PLUMBING WASTE PLAN - ABOVE SECOND FLOOR - PART 2 12/22/2008 02/10/2009 FEB 10 2009 P-103.3 PLUMBING WASTE PLAN - ABOVE SECOND FLOOR - PART 3 12/22/2008 02/10/2009 FEB 10 2009 P-103.4 PLUMBING WATER PLAN - ABOVE SECOND FLOOR - PART 1 12/22/2008 02/10/2009 FEB 10 2009 P-103.5 PLUMBING WATER PLAN - ABOVE SECOND FLOOR - PART 2 12/22/2008 02/10/2009 FEB 10 2009 P-103.6 PLUMBING WATER PLAN - ABOVE SECOND FLOOR - PART 3 12/22/2008 02/10/2009 FEB 10 2009 P-104.1 PLUMBING ROOF PLAN - ABOVE THIRD FLOOR - PART 1 12/22/2008 02/10/2009 FEB 10 2009 P-104.2 PLUMBING ROOF PLAN - ABOVE THIRD FLOOR - WEST 12/22/2008 02/10/2009 FEB 10 2009 P-104.3 PLUMBING ROOF PLAN - ABOVE THIRD FLOOR - EAST 12/22/2008 02/10/2009 FEB 10 2009 P-105.1 PLUMBING PLAN - ABOVE FOURTH FLOOR - WEST 12/22/2008 02/10/2009 FEB 10 2009 P-105.2 PLUMBING PLAN - ABOVE FOURTH FLOOR - EAST 12/22/2008 02/10/2009 FEB 10 2009 P-106.1 PLUMBING PLAN - ABOVE FIFTH FLOOR - ROOF PLAN 12/22/2008 02/10/2009 FEB 10 2009 P-107.1 PLUMBING SCHEDULE, NOTES, LEGEND & DETAILS 12/22/2008 02/10/2009 FEB 10 2009 FP-101.1 FIRE PROTECTION - FIRST FLOOR - PART 1 12/22/2008 02/10/2009 FEB 10 2009 FP-101.2 FIRE PROTECTION - FIRST FLOOR - PART 2 12/22/2008 02/10/2009 FEB 10 2009 FP-101.3 FIRE PROTECTION - FIRST FLOOR - PART 3 12/22/2008 02/10/2009 FEB 10 2009 FP-102.1 FIRE PROTECTION - SECOND FLOOR - PART 1 12/22/2008 02/10/2009 FEB 10 2009 FP-102.2 FIRE PROTECTION - SECOND FLOOR - PART 2 12/22/2008 02/10/2009 FEB 10 2009 FP-102.3 FIRE PROTECTION - SECOND FLOOR - PART 3 12/22/2008 02/10/2009 FEB 10 2009 FP-103.1 FIRE PROTECTION PLAN - THIRD FLOOR - WEST 12/22/2008 02/10/2009 FEB 10 2009 FP-103.2 FIRE PROTECTION PLAN - THIRD FLOOR - EAST 12/22/2008 02/10/2009 FEB 10 2009 FP-104.1 FIRE PROTECTION PLAN - FOURTH FLOOR - WEST 12/22/2008 02/10/2009 FEB 10 2009 Page 8 of 16 Attachment number 1Page 16 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST Project Name: Augusta Richmond County Judicial Center FP-104.2 FIRE PROTECTION PLAN - FOURTH FLOOR - EAST 12/22/2008 02/10/2009 FEB 10 2009 E-001 LEGEND, NOTES & FIXTURE SCHEDULE DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-002 DETAILS DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-003 DETAILS DECEMBER 22, 2008 DEC 22 2008 E-101 DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-201.1 FIRST FLOOR LIGHTING PLAN PART I DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-201.2 FIRST FLOOR LIGHTING PLAN PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-201.3 FIRST FLOOR LIGHTING PLAN PART III DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-202.1 SECOND FLOOR LIGHTING PLAN PART I DECEMBER 22, 2008 DEC 22 2008 E-202.2 SECOND FLOOR LIGHTING PLAN PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-202.3 SECOND FLOOR LIGHTING PLAN PART III DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-203.1 THIRD FLOOR LIGHTING PLAN PART I DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-203.2 THIRD FLOOR LIGHTING PLAN PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-204.1 FOURTH FLOOR LIGHTING PLAN PART I DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-204.2 FOURTH FLOOR LIGHTING PLAN PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-301.1 FIRST FLOOR POWER PLAN PART I DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-301.2 FIRST FLOOR POWER PLAN PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-301.3 FIRST FLOOR POWER PLAN PART III DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-302.1 SECOND FLOOR POWER PLAN PART I DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-302.2 SECOND FLOOR POWER PLAN PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-302.3 SECOND FLOOR POWER PLAN PART III DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-303.1 THIRD FLOOR POWER PLAN PART I DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-303.2 THIRD FLOOR POWER PLAN PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-304.1 FOURTH FLOOR POWER PLAN PART I DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-304.2 FOURTH FLOOR POWER PLAN PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-401.1 FIRST FLOOR MECHANICAL POWER PLAN PART I DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-401.2 FIRST FLOOR MECHANICAL POWER PLAN PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-401.3 FIRST FLOOR MECHANICAL POWER PLAN PART III DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-402.1 SECOND FLOOR MECHANICAL POWER PLAN PART I DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-402.2 SECOND FLOOR MECHANICAL POWER PLAN PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-402.3 SECOND FLOOR MECHANICAL POWER PLAN PART III DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-403.1 THIRD FLOOR MECHANICAL POWER PLAN PART I DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-403.2 THIRD FLOOR MECHANICAL POWER PLAN PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-404.1 FOURTH FLOOR MECHANICAL POWER PLAN PART I DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-404.2 FOURTH FLOOR MECHANICAL POWER PLAN PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-405 MECHANICAL EQUIPMENT CONNECTION SCHEDULES DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 Page 9 of 16 Attachment number 1Page 17 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST Project Name: Augusta Richmond County Judicial Center E-501.1 FIRST FLOOR SYSTEMS PLAN - FIRE ALARM PART I DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-501.2 FIRST FLOOR SYSTEMS PLAN - FIRE ALARM PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-501.3 FIRST FLOOR SYSTEMS PLAN - FIRE ALARM PART III DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-502.1 SECOND FLOOR SYSTEMS PLAN - FIRE ALARM PART I DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-502.2 SECOND FLOOR SYSTEMS PLAN - FIRE ALARM PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-502.3 SECOND FLOOR SYSTEMS PLAN - FIRE ALARM PART III DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-503.1 THIRD FLOOR SYSTEMS PLAN - FIRE ALARM PART I DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-503.2 THIRD FLOOR SYSTEMS PLAN - FIRE ALARM PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-504.1 FOURTH FLOOR SYSTEMS PLAN - FIRE ALARM PART I DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-504.2 FOURTH FLOOR SYSTEMS PLAN - FIRE ALARM PART II DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-601.1 FIRST FLOOR DATA/VOICE INFRASTRUCTURE PLAN PART I DECEMBER 22, 2008 DEC 22 2008 E-601.2 FIRST FLOOR DATA/VOICE INFRASTRUCTURE PLAN PART II DECEMBER 22, 2008 DEC 22 2008 E-601.3 FIRST FLOOR DATA/VOICE INFRASTRUCTURE PLAN PART III DECEMBER 22, 2008 DEC 22 2008 E-602.1 SECOND FLOOR DATA/VOICE INFRASTRUCTURE PLAN PART I DECEMBER 22, 2008 DEC 22 2008 E-602.2 SECOND FLOOR DATA/VOICE INFRASTRUCTURE PLAN PART II DECEMBER 22, 2008 DEC 22 2008 E-602.3 SECOND FLOOR DATA/VOICE INFRASTRUCTURE PLAN PART III DECEMBER 22, 2008 DEC 22 2008 E-603.1 THIRD FLOOR DATA/VOICE INFRASTRUCTURE PLAN PART I DECEMBER 22, 2008 DEC 22 2008 E-603.2 THIRD FLOOR DATA/VOICE INFRASTRUCTURE PLAN PART II DECEMBER 22, 2008 DEC 22 2008 E-604.1 FOURTH FLOOR DATA/VOICE INFRASTRUCTURE PLAN PART I DECEMBER 22, 2008 DEC 22 2008 E-604.2 FOURTH FLOOR DATA/VOICE INFRASTRUCTURE PLAN PART II DECEMBER 22, 2008 DEC 22 2008 E-701 LIGHTINING PROTECTION PLAN DECEMBER 22, 2008 DEC 22 2008 E-801 ELECTRICAL RISER DIAGRAM DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-802 PANEL SCHEDULES DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-803 PANEL SCHEDULES DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 E-804 PANEL SCHEDULES DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 DE-100 SITE PLAN 12/22/08 DEC 22 2008 DE-101 FIRST FLOOR PLAN 12/22/08 DEC 22 2008 DE-101.1 FIRST FLOOR PLAN - PART I 12/22/08 DEC 22 2008 DE-101.2 FIRST FLOOR PLAN - PART II 12/22/08 DEC 22 2008 DE-102 SECOND FLOOR PLAN 12/22/08 DEC 22 2008 DE-102.1 SECOND FLOOR PLAN - PART I 12/22/08 DEC 22 2008 DE-102.2 SECOND FLOOR PLAN - PART II 12/22/08 DEC 22 2008 DE-103 THIRD FLOOR & LOW ROOF PLAN 12/22/08 DEC 22 2008 DE-103.1 THIRD FLOOR & LOW ROOF PLAN - PART I 12/22/08 DEC 22 2008 DE-103.2 THIRD FLOOR & LOW ROOF PLAN - PART II 12/22/08 DEC 22 2008 DE-201 DETENTION EQUIPMENT DETAILS 12/22/08 DEC 22 2008 DE-202 DETENTION EQUIPMENT DETAILS 12/22/08 DEC 22 2008 SC-000 SECURITY SYMBOLS AND LEGEND DECEMBER 22, 2008 DEC 22 2008 SC-001.1 SECURITY SITE PLAN DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 Page 10 of 16 Attachment number 1Page 18 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST Project Name: Augusta Richmond County Judicial Center SC-111.1 SECURITY FIRST FLOOR PLAN PART A DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 SC-111.2 SECURITY FIRST FLOOR PLAN PART B DECEMBER 22, 2008 DEC 22 2008 SC-111.3 SECURITY FIRST FLOOR PLAN PART C DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 SC-112.1 SECURITY SECOND FLOOR PLAN PART A DECEMBER 22, 2008 DEC 22 2008 SC-112.2 SECURITY SECOND FLOOR PLAN PART B DECEMBER 22, 2008 DEC 22 2008 SC-112.3 SECURITY SECOND FLOOR PLAN PART C DECEMBER 22, 2008 DEC 22 2008 SC-113.1 SECURITY THIRD FLOOR PLAN PART A DECEMBER 22, 2008 DEC 22 2008 SC-113.3 SECURITY THIRD FLOOR PLAN PART C DECEMBER 22, 2008 DEC 22 2008 SC-114.1 SECURITY FOURTH FLOOR PLAN PART A DECEMBER 22, 2008 DEC 22 2008 SC-114.3 SECURITY FOURTH FLOOR PLAN PART C DECEMBER 22, 2008 DEC 22 2008 SC-200 SECURITY MARSHALL SECURITY OFFICE CONTROL CONSOLE DECEMBER 22, 2008 DEC 22 2008 SC-201 MARSHALL SECURITY OFFICE CONTROL CONSOLE DETAILS DECEMBER 22, 2008 DEC 22 2008 SC-300 SECURITY CENTRAL CONTROL ROOM CONSOLE DECEMBER 22, 2008 DEC 22 2008 SC-301 SECURITY CENTRAL CONTROL ROOM CONSOLE DETAILS DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 SC-400 SECURITY CCTV SYSTEM DETAILS DECEMBER 22, 2008 DEC 22 2008 SC-401 SECURITY CCTV SYSTEM SCHEDULES DECEMBER 22, 2008 DEC 22 2008 SC-500 SECURITY INTRUSION DETECTION SYSTEM DETAILS DECEMBER 22, 2008 DEC 22 2008 SC-600 SECURITY ACCESS CONTROL AND ALARM MONITORING SYSTEM DETAILS DECEMBER 22, 2008 DEC 22 2008 SC-700 SECURITY INTERCOM SYSTEM DETAILS DECEMBER 22, 2008 DEC 22 2008 SC-800 SECURITY DOOR DETAILS DECEMBER 22, 2008 DEC 22 2008 SC-801 SECURITY DOOR DETAILS DECEMBER 22, 2008 DEC 22 2008 SC-900 SECURITY FUNCTIONAL DIAGRAM DECEMBER 22, 2008 FEBRUARY 10, 2009 FEB 10 2009 AV-000 AUDIOVISUAL SYMBOLS, LEGEND, AND NOTES 12/22/2008 DEC 22 2008 AV-100 DETAILS AND DEVICES 12/22/2008 DEC 22 2008 AV-101 DETAILS AND DEVICES 12/22/2008 DEC 22 2008 AV-102 DETAILS AND DEVICES 12/22/2008 DEC 22 2008 AV-200 AUDIOVISUAL OVERALL FIRST FLOOR PLAN 12/22/2008 DEC 22 2008 AV-201 AUDIOVISUAL OVERALL SECOND FLOOR PLAN 12/22/2008 DEC 22 2008 AV-202 AUDIOVISUAL OVERALL THIRD FLOOR PLAN 12/22/2008 DEC 22 2008 AV-203 AUDIOVISUAL OVERALL FIRST FLOOR RCP 12/22/2008 DEC 22 2008 AV-204 AUDIOVISUAL OVERALL SECOND FLOOR RCP 12/22/2008 DEC 22 2008 AV-205 AUDIOVISUAL OVERALL THIRD FLOOR RCP 12/22/2008 DEC 22 2008 AV-300 AUDIOVISUAL FIRST FLOOR PARTIAL PLAN(S)12/22/2008 DEC 22 2008 AV-301 AUDIOVISUAL FIRST FLOOR RCP PARTIAL PLAN(S)12/22/2008 DEC 22 2008 AV-302 AUDIOVISUAL SECOND FLOOR PARTIAL PLAN(S)12/22/2008 DEC 22 2008 AV-303 AUDIOVISUAL SECOND FLOOR PARTIAL PLAN(S)12/22/2008 DEC 22 2008 Page 11 of 16 Attachment number 1Page 19 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST Project Name: Augusta Richmond County Judicial Center AV-304 AUDIOVISUAL SECOND FLOOR RCP PARTIAL PLAN(S)12/22/2008 DEC 22 2008 AV-305 AUDIOVISUAL SECOND FLOOR RCP PARTIAL PLAN(S)12/22/2008 DEC 22 2008 AV-306 AUDIOVISUAL THIRD FLOOR PARTIAL PLAN(S)12/22/2008 DEC 22 2008 AV-307 AUDIOVISUAL THIRD FLOOR PARTIAL PLAN(S)12/22/2008 DEC 22 2008 AV-308 AUDIOVISUAL THIRD FLOOR RCP PARTIAL PLAN(S)12/22/2008 DEC 22 2008 AV-309 AUDIOVISUAL THIRD FLOOR RCP PARTIAL PLAN(S)12/22/2008 DEC 22 2008 00 01 01 PROJECT TITLE PAGE December 22, 2008 00 01 05 CERTIFICATIONS PAGE December 22, 2008 00 01 10 TABLE OF CONTENTS December 22, 2008 February 10, 2009 FEB 12 2009 00 72 00 GENERAL CONDITIONS September 15, 2008 Spec. Section SPECIFICATION NAME GMP DOCUMENTS ISSUE DATE GMP ADDENDUM ISSUE DATE TPC RECV'D STAMP DATE END OF DRAWINGS p, 01 00 10 PROJECT DIRECTORY September 15, 2008 February 10, 2009 FEB 12 2009 01 21 00 ALLOWANCES December 22, 2008 01 22 00 UNIT PRICES September 15, 2008 01 23 00 ALTERNATES December 22, 2008 01 25 13 PRODUCT SUBSTITUTION PROCEDURES September 15, 2008 01 29 00 PAYMENT PROCEDURES September 15, 2008 01 29 73 SCHEDULES OF VALUES September 15, 2008 01 31 13 PROJECT COORDINATION September 15, 2008 01 31 19 PROJECT MEETINGS September 15, 2008 01 32 16 CONSTRUCTION PROGRESS SCHEDULES September 15, 2008 01 32 33 PHOTOGRAPHIC DOCUMENTATION July 8, 2008 01 33 00 SUBMITTAL PROCEDURES September 15, 2008 01 41 14 SPECIAL INSPECTIONS September 15, 2008 01 43 38 PROJECT SITE MOCK-UPS December 22, 2008 01 45 29 TESTING LABORATORY SERVICES September 15, 2008 01 50 00 TEMPORARY FACILITIES AND CONTROLS September 15, 2008 01 65 00 PRODUCT DELIVERY, STORAGE, AND HANDLING September 15, 2008 01 73 29 CUTTING AND PATCHING November 5, 2008 01 74 00 CLEANING AND WASTE MANAGEMENT September 15, 2008 01 78 00 CLOSEOUT SUBMITTALS September 15, 2008 01 78 23.16 MAINTENANCE DATA September 15, 2008 01 78 34 WARRANTIES AND BONDS November 5, 2008 01 78 39 PROJECT RECORD DOCUMENTS September 15, 2008 01 91 10 GENERAL COMMISSIONING REQUIREMENTS FEB 12 2009 FEB 12 2009 02 30 00 SUBSURFACE INVESTIGATIONS September 15, 2008 03 06 00 SCHEDULES FOR CAST-IN-PLACE CONCRETE November 5, 2008 03 30 00 CAST-IN-PLACE CONCRETE November 5, 2008 February 10, 2009 FEB 12 2009 Page 12 of 16 Attachment number 1Page 20 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST Project Name: Augusta Richmond County Judicial Center 03 35 00 CONCRETE FINISHING November 5, 2008 03 35 19 COLORED CONCRETE FINISHING September 29, 2008 03 38 16 UNBONDED POST-TENSIONED CONCRETE November 5, 2008 04 05 13 MASONRY MORTARING December 22, 2008 04 05 16 MASONRY GROUTING December 22, 2008 04 05 19 MASONRY ANCHORAGE AND REINFORCING December 22, 2008 04 05 23 MASONRY ACCESSORIES December 22, 2008 04 21 13 BRICK MASONRY December 22, 2008 04 21 14 BRICK VENEER MASONRY December 22, 2008 04 22 00 CONCRETE UNIT MASONRY December 22, 2008 04 42 00 EXTERIOR STONE CLADDING December 22, 2008 February 10, 2009 FEB 12 2009 04 70 13 CALCIUM SILICATE MANUFACTURED BLOCK MASONRY December 22, 2008 February 10, 2009 FEB 12 2009 04 72 00 CAST STONE MASONRY December 22, 2008 February 10, 2009 FEB 12 2009 05 05 13 SHOP-APPLIED COATINGS FOR METAL December 22, 2008 05 12 00 STRUCTURAL STEEL FRAMING December 22, 2008 05 40 00 COLD FORMED METAL FRAMING December 22, 2008 05 50 00 METAL FABRICATIONS December 22, 2008 05 51 00 METAL STAIRS December 22, 2008 06 10 00 ROUGH CARPENTRY December 22, 2008 06 20 00 FINISH CARPENTRY D b 22 2008 F b 10 2009 FEB 12 200906 20 00 FINISH CARPENTRY December 22, 2008 February 10, 2009 FEB 12 2009 06 61 16 SOLID SURFACING FABRICATIONS December 22, 2008 06 82 13 GLASS-FIBER-REINFORCED PLASTIC FABRICATIONS December 22, 2008 February 10, 2009 FEB 12 2009 07 16 16 CRYSTALLINE WATERPROOFING November 5, 2008 07 21 00 THERMAL INSULATION December 22, 2008 07 22 00 ROOF AND DECK INSULATION December 22, 2008 07 26 00.13 VAPOR RETARDERS November 5, 2008 07 26 00.16 VAPOR BARRIERS November 5, 2008 07 27 26 FLUID-APPLIED MEMBRANE ROOFING AIR BARRIERS December 22, 2008 07 52 13 ATACTIC-POLYPROPYLENE-MODIFIED BITUMINOUS MEMBRANE ROOFING December 22, 2008 07 60 00 FLASHING AND SHEET METAL December 22, 2008 07 65 10 FLEXIBLE FLASHING/DRAINAGE SYSTEM December 22, 2008 07 72 13 MANUFACTURED CURBS December 22, 2008 07 72 33 ROOF HATCHES December 22, 2008 07 81 12 SPRAY APPLIED FIREPROOFING December 22, 2008 07 84 00 FIRESTOPPING December 22, 2008 07 91 00 PREFORMED JOINT SEALS December 22, 2008 07 92 00 JOINT SEALANTS December 22, 2008 08 11 00 METAL DOORS AND FRAMES December 22, 2008 08 14 00 WOOD DOORS December 22, 2008 08 31 00 ACCESS DOORS AND PANELS December 22, 2008 08 34 63 DETENTION DOORS AND FRAMES December 22, 2008 08 35 13.23 FOLDING FIRE DOORS December 22, 2008 08 41 13 ALUMINUM FRAMED ENTRANCES AND STOREFRONTS December 22, 2008 February 10, 2009 FEB 12 2009 08 42 26 ALL-GLASS ENTRANCES December 22, 2008 08 71 00 DOOR HARDWARE December 22, 2008 08 71 00 A DOOR HARDWARE INDEX December 22, 2008 08 71 63 DETENTION HARDWARE December 22, 2008 Page 13 of 16 Attachment number 1Page 21 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST Project Name: Augusta Richmond County Judicial Center 08 80 00 GLAZING December 22, 2008 February 10, 2009 FEB 12 2009 08 88 53 SECURITY GLASS AND GLAZING December 22, 2008 08 91 00 LOUVERS December 22, 2008 09 06 00 SCHEDULE FOR FINISHES December 22, 2008 February 10, 2009 FEB 12 2009 09 21 16 GYPSUM BOARD ASSEMBLIES December 22, 2008 09 23 13.13 ACOUSTICAL FINISH SYSTEM December 22, 2008 February 10, 2009 FEB 12 2009 09 27 13 GLASS FIBER REINFORCED PLASTER FABRICATIONS December 22, 2008 December 22, 2008 FEB 12 2009 09 30 00 TILING December 22, 2008 09 51 00 ACOUSTICAL CEILINGS December 22, 2008 February 10, 2009 FEB 12 2009 09 65 00 RESILIENT FLOORING December 22, 2008 09 66 23.16 EPOXY TERRAZZO FLOORING December 22, 2008 February 10, 2009 FEB 12 2009 09 67 23.13 EPOXY AGGREGATE FLOORING December 22, 2008 09 68 00 CARPETING December 22, 2008 09 72 00 WALL COVERING December 22, 2008 09 81 00 ACOUSTIC INSULATION December 22, 2008 09 84 13 FIXED SOUND-ABSORPTIVE PANELS December 22, 2008 09 91 00 PAINTING December 22, 2008 10 21 13.14 PHENOLIC TOILET COMPARTMENTS December 22, 2008 10 23 13 TOILET ACCESSORIES December 22, 2008 10 44 14 FIRE EXTINGUISHERS CABINETS AND ACCESSORIES D b 22 200810 44 14 FIRE EXTINGUISHERS, CABINETS, AND ACCESSORIES December 22, 2008 10 75 00 FLAGPOLES December 22, 2008 10 80 00 OTHER BUILDING SPECIALTIES December 22, 2008 11 19 00 BASIC REQUIREMENTS FOR DETENTION SYSTEMS December 22, 2008 11 19 20 DETENTION ACCESSORIES December 22, 2008 11 19 50 DETENTION METAL FABRICATIONS December 22, 2008 11 33 00 RESIDENTIAL KITCHEN APPLIANCES December 1, 2008 11 52 13.13 FRONT PROJECTION SCREENS December 22, 2008 12 21 13.13 METAL HORIZONTAL LOUVER BLINDS December 22, 2008 12 21 26 BLACK-OUT BLINDS December 22, 2008 12 48 13 ENTRANCE FLOOR MATS AND FRAMES December 22, 2008 12 55 00 SECURITY FURNITURE December 22, 2008 Feb. 10, 2009 FEB 12 2009 14 21 23 ELECTRIC TRACTION ELEVATORS December 22, 2008 February 10, 2009 FEB 12 2009 14 24 23 HYDRAULIC ELEVATORS December 22, 2008 February 10, 2009 FEB 12 2009 21 00 00 GENERAL FIRE SUPPRESSION PROVISIONS December 22, 2008 21 05 00 COMMON WORK RESULTS FOR FIRE SUPPRESSION December 22, 2008 20 05 13 COMMON MOTOR REQUIREMENTS FOR FIRE SUPPRESSION EQUIPMENT December 22, 2008 21 05 60 FIRE SUPPRESSION PIPING December 22, 2008 21 10 00 FIRE HOSE VALVE CABINETS February 10, 2009 FEB 12 2009 21 31 13 ELECTRIC-DRIVE, HORIZONTAL FIRE PUMPS December 22, 2008 22 00 00 GENERAL PLUMBING PROVISIONS December 22, 2008 22 05 00 BASIC MECHANICAL MATERIALS AND METHODS December 22, 2008 22 05 13 COMMON MOTOR REQUIREMENTS FOR PLUMBING EQUIPMENT December 22, 2008 22 05 19 METERS AND GAGES FOR PLUMBING PIPING December 22, 2008 22 05 23 GENERAL DUTY VALVES FOR PLUMBING PIPING December 22, 2008 22 05 29 HANGERS AND SUPPORTS FOR PLUMBING PIPING AND EQUIPMENT December 22, 2008 22 05 33 HEAT TRACING FOR PLUMBING PIPING December 22, 2008 22 05 53 IDENTIFICATION FOR PLUMBING PIPING AND EQUIPMENT December 22, 2008 Page 14 of 16 Attachment number 1Page 22 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST Project Name: Augusta Richmond County Judicial Center 22 07 00 PLUMBING INSULATION December 22, 2008 22 11 16 WATER DISTRIBUTION PIPING December 22, 2008 February 10, 2009 FEB 12 2009 22 11 19 PLUMBING SPECIALTIES December 22, 2008 22 11 23 WATER DISTRIBUTION PUMPS December 22, 2008 22 11 24 DOMESTIC-WATER PACKAGED BOOSTER PUMPS February 10, 2009 FEB 12 2009 22 13 16 DRAINAGE AND VENT PIPING December 22, 2008 22 33 00 ELECTRIC WATER HEATERS December 22, 2008 22 40 00 PLUMBING FIXTURES December 22, 2008 February 10, 2009 FEB 12 2009 22 40 50 ELEVATOR SUMP PUMPS December 22, 2008 22 46 00 SECURITY PLUMBING FIXTURES February 10, 2009 FEB 12 2009 23 00 00 GENERAL HVAC PROVISIONS December 22, 2008 23 05 00 COMMON WORK RESULTS FOR HVAC December 22, 2008 23 05 13 COMMON MOTOR REQUIREMENTS FOR HVAC EQUIPMENT December 22, 2008 23 05 14 MOTOR CONTROLLERS FOR HVAC EQUIPMENT December 22, 2008 23 05 19 MATERS AND GAGES FOR HVAC PIPING AND DUCTWORK December 22, 2008 23 05 23 GENERAL DUTY VALVES FOR HVAC PIPING December 22, 2008 23 05 29 HANGERS AND SUPPORTS FOR HVAC PIPING AND EQUIPMENT December 22, 2008 23 05 33 HEAT TRACING FOR HVAC PIPING December 22, 2008 23 05 48 VIBRATION AND SEISMIC CONTROLS FOR HVAC PIPING AND EQUIPMENT December 22, 2008 23 05 53 INDENTIFICATION FOR HVAC PIPING AND EQUIPMENT D b 22 200823 05 53 INDENTIFICATION FOR HVAC PIPING AND EQUIPMENT December 22, 2008 23 05 93 TESTING, ADJUSTING, AND BALANCING December 22, 2008 23 07 00 HVAC INSULATION December 22, 2008 23 08 00 MECHANICAL COMMISSIONING REQUIREMENTS FEB 12 2009 FEB 12 2009 23 09 00 CONTROL SYSTEMS EQUIPMENT December 22, 2008 February 10, 2009 FEB 12 2009 23 09 93 SEQUENCE OF OPERATION December 22, 2008 23 21 13 HYDRONIC PIPING December 22, 2008 23 21 23 HVAC PUMPS December 22, 2008 23 23 00 REFRIGERANT PIPING AND CONDENSATE DRAINS December 22, 2008 23 25 00 CHEMICAL WATER TREATMENT December 22, 2008 23 31 13 METAL DUCTWORK December 22, 2008 23 31 16 FIBROUS GLASS DUCT SYSTEMS December 22, 2008 23 33 00 DUCT ACCESSORIES December 22, 2008 23 34 23 POWER AND GRAVITY VENTILATORS December 22, 2008 23 36 00 AIR TERMINALS December 22, 2008 February 10, 2009 FEB 12 2009 23 37 13 DIFFUSERS, REGISTERS, GRILLES AND LOUVERS December 22, 2008 23 64 16 WATER-COOLED CENTRIFUGAL CHILLERS December 22, 2008 23 65 00 FACTORY-FABRICATED COOLING TOWERS December 22, 2008 23 73 13 CENTRAL-STATION AIR-HANDLING UNITS December 22, 2008 23 81 23 COMPUTER-ROOM AIR-CONDITIONING UNITS December 22, 2008 23 82 39 UNIT HEATERS December 22, 2008 26 05 00 COMMON WORK RESULTS FOR ELECTRICAL December 22, 2008 26 05 19 LOW-VOLATAGE ELECTRICAL POWER CONDUCTORS AND CABLES December 22, 2008 26 05 26 GROUNDING AND BONDING FOR ELECTRICAL SYSTEMS December 22, 2008 26 05 29 HANGERS AND SUPPORTS FOR ELECTRICAL SYSTEMS December 22, 2008 26 05 33 RACEWAY AND BOXES FOR ELECTRICAL SYSTEMS December 22, 2008 26 05 36 CABLE TRAYS FOR ELECTRICAL SYSTEMS December 22, 2008 26 05 43 UNDERGROUND DUCTS AND RACEWAYS FOR ELECTRICAL SYSTEMS December 22, 2008 Page 15 of 16 Attachment number 1Page 23 of 57 Date: 2/20/2009 EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "B" CONTRACT DOCUMENT LIST Project Name: Augusta Richmond County Judicial Center 26 05 53 IDENTIFICATION FOR ELECTRICAL SYSTEMS December 22, 2008 26 08 00 ELECTRICAL COMMISSIONING FEB 12 2009 FEB 12 2009 26 09 23 LIGHTING CONTROL DEVICES December 22, 2008 26 09 43 NETWORK LIGHTING CONTROLS December 22, 2008 26 22 00 LOW-VOLTAGE TRANSFORMERS December 1, 2008 26 24 13 SWITCHBOARDS December 22, 2008 February 10, 2009 FEB 12 2009 26 24 16 PANELBOARDS December 22, 2008 February 10, 2009 FEB 12 2009 26 27 26 WIRING DEVICES December 22, 2008 26 28 13 FUSES December 22, 2008 26 28 16 ENCLOSED SWITCHES AND CIRCUIT BREAKERS December 22, 2008 26 32 13 ENGINE GENERATORS December 22, 2008 February 10, 2009 FEB 12 2009 26 36 00 TRANSFER SWITCHES February 10, 2009 FEB 12 2009 26 41 13 LIGHTNING PROTECTION FOR STRUCTURES December 22, 2008 26 43 13 TRANSIENT-VOLTAGE SUPPRESION FOR LOW-VOLTAGE ELECTRICAL POWER CIRCUITS December 22, 2008 February 10, 2008 FEB 12 2009 26 51 00 INTERIOR LIGHTING December 22, 2008 26 56 00 EXTERIOR LIGHTING December 22, 2008 27 05 00 COMMON WORK RESULTS FOR COMMUNICATIONS December 22, 2008 27 11 00 COMMUNICAITONS EQUIPMENT ROOM FITITNGS December 22, 2008 27 13 00 COMMUNICATIONS BACKBONE CABLING December 22, 2008 27 15 00 COMMUNICAITONS HORIZONTAL CABLING D b 22 200827 15 00 COMMUNICAITONS HORIZONTAL CABLING December 22, 2008 27 41 33 MASTER ANTENNA TELEVISION SYSTEM December 22, 2008 28 00 10 SECURITY GENERAL December 22, 2008 28 00 90 SECURITY COMMISSIONING February 10, 2009 FEB 12 2009 28 10 00 SECURITY SYSTEMS December 22, 2008 February 10, 2009 FEB 12 2009 28 11 00 CLOSED CIRCUIT TELEVISION SYSTEMS December 22, 2008 28 31 11 DIGITAL, ADDRESSABLE FIRE-ALARM SYSTEM December 22, 2008 31 10 00 CLEARING AND GRUBBING September 15, 2008 31 20 00 EARTHWORK September 15, 2008 31 23 00 EXCAVATING, TRENCHING AND BACKFILLING FOR PIPE LINES September 17, 2008 31 25 00 EROSION, SEDIMENTATION & POLLUTION CONTROL MEASURES September 17, 2008 31 31 16 TERMITE CONTROL December 22, 2008 31 63 16 AUGER CAST GROUT PILES December 22, 2008 February 10, 2009 FEB 12 2009 32 11 23 GRADED AGGREGATE BASE COURSE December 22, 2008 32 12 16 ASPHALT PAVING September 15, 2008 32 12 43 FLEXIBLE POROUS PAVEMENT December 22, 2008 32 14 16 BRICK AND LIMESTONE UNIT PAVING December 22, 2008 32 16 13 CONCRETE CURBS AND GUTTERS September 15, 2008 30 31 17 VEHICULAR HIGH SECURITY GATES December 22, 2008 February 10, 2009 FEB 12 2009 32 40 00 CONCRETE CONSTRUCTION - CIVIL September 15, 2008 32 80 00 IRRIGATION December 22, 2008 32 90 00 PLANTS December 22, 2008 32 92 23 SODDING December 22, 2008 33 10 00 WATER UTILITIES September 17, 2008 33 30 00 SANITARY SEWERAGE UTILITIES September 15, 2008 33 40 00 STORM DRAINAGE UTILITIES September 15, 2008 END OF SPECIFICATIONS Page 16 of 16 Attachment number 1Page 24 of 57 1 Otis Elevator Company North American Area 1575 Northside Drive NW Suite 460 Atlanta, GA 30318 January 31, 2009/Revised February 18, 2009 Mr. Josh Spencer C/O The Potts Company 981 East Freeway Drive Conyers, GA 30094 Reference: Augusta Richmond County Judicial Center Augusta, GA 30911 Dear: Josh We are pleased to provide you with our proposal to furnish and install: Two (2)4000lbs Otis Gen2 series elevator system (Public Passenger Elevators # 1 & 2) One (1) 3500lbs Otis Gen2 series elevator system (Judges Elevator # 3) One (1) 4500lbs Otis LVM series holed elevator system (Prisoner Elevator # 4) One (1) 4500lbs Otis LVM series holed elevator system (Prisoner Elevator # 5) as described in this proposal for the sum of Seven Hundred Seventy Thousand Dollars and No Cents ($ 770,000.00) Please take note of the following sections, which are a part of this proposal: x Scope of Work x Value Engineering Options x General Clarifications x Job Specific Clarifications/Exceptions to Specification x Terms and Conditions x Preparatory Work by Others This quotation is valid for thirty (30) days from the date of submission. Otis predicates the quote upon timely furnishing of a completed hoistway for uninterrupted use. In addition, if delivery material cannot be taken at the jobsite by 12/31/2009 or the installation of the elevators is delayed beyond 12/31/2010 you will be responsible for any labor and material increases that have occurred. I have included 16 hours per elevator allowance for coordination of trades inside the hoistway as well as 60 days temporary use of one elevator for construction purposes in my base bid.We appreciate having the opportunity to provide you with our proposal on this project and look forward to working with you and your project team. Please call me at (404) 557-7086 with any questions. Sincerely, Jeff Nedblake Account Executive-New Equipment AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 1 of 23 Attachment number 1Page 25 of 57 2 SCOPE OF WORK (2) Passenger Elevators Elevator Designation # 1 & 2 Public Passenger Cars Otis Model Otis Gen2 series elevator system; GN24000 ( 3500 specified ) Capacity and Speed 4000lbs @ 350 feet per minute Rise 50’ 8’’ Number Of Stops And Openings Four (4): Four (4) front openings only. Minimum Clear Hoistway 9’ 4” wide x 7’ 10” deep Clear Car Inside Dimensions 7’ 8”wide x 5’ 5” deep Minimum Clear Overhead 17’ 2’’ Minimum Clear Pit Depth 5’ 6’’ Control Room/Space Located adjacent to # 2 hoistway at 4 th landing. Operation Duplex Elevonic® Microprocessor control Power Supply 480 Volts, 3 Phase AC, 60 Hertz Cab Enclosure Cab shell to specifications except in lieu of 10’ high cab to canopy we provide a 9’ 7” high cab with @ 8’ 11 1/2” height under ceiling.8’ high 48”Center opening-car doors with Satin Stainless finish. Included is a $15,000.00 per elevator allowance for custom designed ceiling, wall panels and handrails. Cab Flooring Furnished and installed by others Hoistway Entrances 4’wide x 8’ 0” high Center-opening doors with Satin Stainless finish. Extruded aluminum sills. Signals Dual Otis Classic line illuminated car operating panel contained in swing front returns with vandal resistant buttons with digital position indicator, Otis Classic line hall fixtures with stainless steel faceplates and vandal resistant push buttons per specifications. AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 2 of 23 Attachment number 1Page 26 of 57 3 SCOPE OF WORK (1) Passenger Elevator Designation (1) Passenger – Judges Elevator # 3 Otis Model Otis Gen2 series elevator system ; GN23500 Capacity and Speed 3500lbs @ 350 feet per minute Rise 50’ 8’’ Number Of Stops And Openings Four (4): Four (4) front openings only. Minimum Clear Hoistway 8’ 4” wide x 7’ 10” deep Clear Car Inside Dimensions 6’ 8” wide x 5’ 5” deep Minimum Clear Overhead 17’ 2’’ Minimum Clear Pit Depth 5’ 6’’ Control Room/Space Located either. Operation Simplex Elevonic® Microprocessor control Power Supply 480 Volts, 3 Phase AC, 60 Hertz Cab Enclosure Cab shell with an 8’ high cab with @ 7’ 5” height under ceiling. 7’ high Side Slide doors with Satin Stainless finish. Standard Wilsonart Plastic Laminate wall panels and fluorescent lighting included as are handrails on side and rear walls. Cab Flooring Furnished and installed by others Hoistway Entrances 3’ 6” wide x 7’ 0” high. Side-opening door. Satin Stainless finish. Extruded aluminum sills. Signals Single Otis Classic line illuminated car operating panel contained in swing front returns with vandal resistant buttons with digital position indicator, Otis Classic line hall fixtures with stainless steel faceplates and vandal resistant push buttons per specifications. AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 3 of 23 Attachment number 1Page 27 of 57 4 SCOPE OF WORK (2) Simplex Service Elevators Elevator Designation Prisoner Elevators # 4 & # 5 Otis Model Otis LVM series holed elevator system Hydraulic; LVM4500 Capacity and Speed 4500lbs @ 150 FPM Rise 32’ 8’’ Number Of Stops And Openings Three (3): Three (3) front openings only. Clear Hoistway 7’ 5” wide x 9’ 8” deep Clear Car Inside Dimensions 5’ 8” wide x 7’ 11 deep Clear Overhead 12’ 8’’ Clear Pit Depth 4’ 0’’ Machine Room Location Directly adjacent to hoistway at lowest floor landing Operation Simplex microprocessor control Power Supply 480 Volts, 3 Phase AC, 60 Hertz Motor Horsepower 50 HP Cab Enclosure Otis Series 3 Service RIGID steel cab shell walls. and rear walls. Full Satin stainless front return, header and satin stainless cab door. Aluminum threshold. 7’ 0” high cab doors. 8’ 0” high cab. 7’ 4 1/2” height under ceiling. Special lighting to specification included. Otis DH-154 (1-1/2”) round tubular handrail provided on the sides and rear of the car enclosure with satin stainless steel finish. Bumper Rail included that is 8” tall. Cab Flooring Furnished and installed by others Hoistway Entrances 4’ 0” wide x 7’ 0” high. Two-speed single-slide door. Satin Stainless finish. Extruded aluminum sills. Signals Otis Classic line illuminated car operating panel contained in swing front return with vandal resistant buttons with digital position indicator, Otis Classic line hall fixtures with stainless steel faceplates and vandal resistant push buttons. AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 4 of 23 Attachment number 1Page 28 of 57 5 Value Engineering Options 1. Provide the passenger cars as 3500# duty with side slide doors and single car operating panel in lieu of our proposed 4000# duty, center opening doors and dual car operating panels ---Delete $20,000.00 (Twenty Thousand Dollars) from our proposal price. 2. Delete the Security Control Panel and Fire Fighter Control Panel from the project Specifications that are listed on page 7 and 8 of the traction elevator spec under additional features section and signal fixture section. ----Deduct $6,000.00 (Six Thousand Dollars) from our Proposal Price. 3. Delete the requirement for the Elevator Management System/Machine Room Display Unit that is specified on page 20 of the traction elevator specification under section 2.12.C as well as being referenced in the last sentence on page 11 of traction specification, section 2.04 Item F and on page 13 under section 2.05.E.6---monitoring system interface and then again in the hydraulic specification on page 10 under section 2.05.D item 6. Deduct $10,000.00 (Ten Thousand Dollars) from our proposal price. 4. Delete the requirement for the following items to be located in the locked service cabinet on all traction elevators that is found on page 18 of the traction specification ( section 2.08.Q.11 ) : Item E ( constant pressure test button for emergency lighting…we will provide it but on car top, not in locked service cabinet ), Item G ( card reader override switch – delete in its entirety ) and Item I ( switch to select either voice , tone or chime – delete in its entirety ) in addition Delete the requirement for the following items to be located in the locked service cabinet on all elevators that is found on page 15 of the hydraulic specification ( section 2.08.Q.11 ) : Item E ( constant pressure test button for emergency lighting…we will provide it but on car top, not in locked service cabinet ), Item H ( switch to select either voice , tone or chime – delete in its entirety ) and Item I ( car lighting dimmer switch ). Deduct $9,000.00 ( Nine Thousand Dollars from our Proposal price ) AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 5 of 23 Attachment number 1Page 29 of 57 6 General Clarifications 1. Our bid is based on manufacturing lead-time of 12 weeks after approvals. 2. Our bid is based on providing our standard components that most closely match that specified. The specifications include items which vary slightly from our standard manufacturing processes. Our quotation is based on standard Otis performance times, heat release/HP amps and ride quality performance/ISO perception filter measurements.All Otis Hoistway door frames are bolted/lapped. Our proposal is based on providing our Otis fixtures, Braille, tactile markings and fonts. Car operating panel including button configuration shall be per our standard design. 3. Where applicable, powder coated finishes and metal finishes shall be from Otis standard manufacturing process and color selection. We are now using a powder coated finish where baked enamel is required which has a higher resistance to corrosion, chemicals, heat abrasion and impact over the traditional baked enamel finish. Plastic laminate if applicable shall be from our standard selections and edging, Wilson Art Design Group 1, (approx. 250 choices). 4. Warranty is for Twelve (12) months after acceptance of elevator by owner. The elevator contractor’s acceptance is conditional on the understanding that their warranty covers defective material and workmanship. The guarantee period shall not extend longer than one (1) year from the date of completion or acceptance thereof by beneficial use, whichever is earlier, of each elevator. The guarantee excludes ordinary wear and tear or improper use, vandalism, abuse, misuse, or neglect or any other causes beyond the control of the elevator contractor and this express warranty is in lieu of all other warranties, express or implied, including any warranty of merchantability or fitness for a particular purpose. This express warranty is in lieu of all other warranties, expressed or implied, including any warranty or merchantability or fitness for a particular purpose. 5. Contract includes Twelve (12) months of full maintenance for each elevator after acceptance of elevator by owner including 24 hour emergency callback service. 6. Our proposal is based on Otis providing a single piece plunger and cylinder. We are assuming we will have access to set the piston and cylinder through the roof in a single section. 7. The hydraulic elevator cylinder wells will be provided by us based upon excavation through normal soil or clay, which can be removed by manual digging or with a standard truck-mounted regular drilling unit. If during excavation, it is determined that a casing must be provided to retain the walls of the well, we will provide a casing as required. Removal of excavation spoils deposited at the elevator pit will not be our responsibility. 8. If any physical obstruction or hindrance is encountered below the surface of the ground, including but not limited to boulders, rock, gravel, wood, metal, pilings, water, sand, quicksand, caves, public utilities, or any other foreign material, you will provide us with written authorization to proceed with excavation utilizing any required special excavation equipment. There will be an additional charge of $200 per foot for drilling through rock/ledge.( We have included firm price drilling in lieu of the $200 per foot rock clause. )We will be compensated at our current billing rates on a time and material basis for the additional costs incurred subsequent to encountering the physical obstruction or hindrance, including costs of the special excavation equipment. Protection for the installed hydraulic elevator cylinder shall be provided at no cost to us. You must dispose of spoils from well hole drilling. 9. The following close-out documents will be provided: our standard owner’s information manual, our standard final layout/installation drawings, and our standard warranty. Unless otherwise specified, 2 copies of each will be provided. Additional copies are available at $100 per set. AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 6 of 23 Attachment number 1Page 30 of 57 7 Project Specific Clarifications/Exceptions to Specification 1. All Equipment is provided for Seismic Zone 1. 2. Our proposal includes providing the 2 passenger cars as 4000# with center opening doors and dual car operating panels. This is an upgrade to the specification and we have provided an VE deduct to provide these cars as specified : 3500 # with side slide doors and single car operating panel. 3. We are unable to provide a 10’ canopy for the passenger elevators. We will provide a 9’ 7” canopy height for elevators 1 & 2 in lieu of the 10’ canopy specified. 4. Regarding Car Performance, section 2.03 on page 9 of the traction specification our equipment performance varies slightly. Item D we open our doors in 2.05 vs. 2.0 seconds and we close our doors in 2.9 seconds vs. 2.4 seconds. 5. No handheld/laptop service tool is included in proposal,nor required for other Elevator Companies to service the Otis Equipment proposed for this project. 6. Hoistways, Pits, Overheads and machine/control rooms must be sized to suit Otis minimum requirements. x Public Cars # 1 & 2 will need 17’ 2” total clear overhead, 5’ 6” deep pits and the hoistway width and depth are ok for either 3500 or 4000# cars. x Judges Elevator # 3 will need 15’ 6” total clear overhead, 5’ 6” deep pits and the hoistway will be need to be deepened by 1” to 7’ 10” deep vs. 7’ 9” shown on plans. Width can be shrunk to 8’ 4”. x Each Prisoner Elevator will need 12’ 3” total clear overhead, 4’ deep pits and the hoistways are ok W X D although we prefer 7’ 5” W x 9’ 8” D. x I believe the Traction Elevator Control Room # 441 is too small to accommodate Elevators # 1, 2 & 3. I believe that # 3 Judges Elevator control room could be located in the same room on the 1 st floor as the # 4 Prisoner Elevator ( room # 126.02 ). My suggestion is to enlarge the room # 441 to accommodate all 3 traction elevators…..Our proposal cost includes either option with the understanding that the total wire run distance from the elevator controller to the hoist machine/IMBS which is located in the top of the hoistway cannot exceed 150’. AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 7 of 23 Attachment number 1Page 31 of 57 8 Terms and Conditions 1. This proposal is submitted with the understanding that any contract resulting therefrom will be subject to review & mutual acceptance of all terms and conditions contained therein. It is conditioned on neither party being liable to the other for any loss, damage or delay due to any cause beyond either party’s reasonable control, including but not limited to, acts of government, strikes, lockouts, other labor disputes, fire, explosion,theft, water damage, flood, earthquake, riot, civil commotion, war, malicious mischief or act of God. Under no conditions, shall either party be liable for special, indirect, liquidated, or consequential damages in contract, tort, including negligence, warranty or otherwise, notwithstanding any indemnity provisions to the contrary. Notwithstanding any provision in any contract document to the contrary, our acceptance is conditioned on being allowed additional time for the performance of the Work due to delays beyond our reasonable control. Subcontractor agrees to submit to Non-Binding Arbitration by the American Arbitration Association but does not waive its rights to pursue other remedies available at law & equity. 2. It is agreed that Otis shall not be responsible for any Liquidated Damages. Should the contract documents require provisions for Liquidated Damages, our bid is contingent upon review of the schedule to assure we can achieve the desired date with our standard lead times. 3. In the event Contractor does not accept Otis Standard Commercial Terms and the Otis Acknowledgement Letter, contract price may be altered to reflect any additional burden of risk to Otis Elevator. 4. We agree to provide evidence of insurance coverage but cannot name others as additional insured or waive our rights of subrogation. All insurance coverage afforded to you or others shall terminate upon final acceptance of the work. If “Owners and Contractors Protective Insurance” is required in addition to our standard Certificate of insurance add ($8.00 per $1000). If the project is covered by an Owner/Contractor Controlled Insurance Program ("OCIP/CCIP), Otis agrees to participate provided it is at no cost to Otis and subject to review and acceptance of the proposed program. The OCP obligation is waived and any obligation to name others as Additional Insured shall be for off-site operations only. 5. Otis will provide surety bond(s) in the form provided by Otis' Surety at no cost to Otis. This is in lieu of participation in any type of surety wrap-up or Subguard program.If payment and performance bonds are requested of us, please add ($8.00 per $1000) of resulting contract amount. 6. Security for elevator material delivered to the jobsite is the responsibility of the Contractor. The Contractor is responsible for all costs to replace any damaged, stolen or missing elevator equipment. Otis will not be responsible for deductibles on Builder's Risk insurance policies. Otis will provide a change order, police report, and affidavits as needed to substantiate the claim. Otis will not procure replacement equipment until a signed change order is received. 7. If you are not ready to accept delivery of the material on the date the machine room is to be ready, you shall give us sufficient notice of a local point where you will accept delivery, and be responsible for all monthly storage fees. An extra charge will be assessed for any double handling or re-transportation of elevator material required by the general contractor/owner or agent thereof. 8. Our proposal includes our Remote Elevator Monitoring (REM®) feature. This feature will be installed during the original installation for the duration of the warranty/maintenance period. Upon expiration of this service period, if the owner elects not to continue maintenance with Otis, it is understood that this REM unit will be removed by Otis from the jobsite and remain in our possession. AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 8 of 23 Attachment number 1Page 32 of 57 9 Contract Number TBD Base Contract Amount $770,000 Number of units 5 Upon Issuance of PO/Contract 50% 385,000.00$ 70% of Remaining Balance 1/5 of remaining balance 1/5 of Remaining Balance 1/5 of Remaining Balance 1/5 of Remaining Balance 1/5 of Remaining Balance Due Date Description Value Upon Delivery of Material 269,500.00$ Upon Substantial Completion of 1st elevator 23,100.00$ 23,100.00$ 23,100.00$ Upon Substantial Completion of 2nd elevator 23,100.00$ Upon Substantial Completion of 3nd elevator Augusta Richmond County Judicial CTR Upon Substantial Completion of 4th elevator 23,100.00$ Upon Substantial Completion of 5th elevator 9. Otis will not supply information such as internal Otis manuals, manufacturing drawings or source code. Any counters, meters, tools, remote monitoring devices, communication devices, or other such equipment that we may use or install to deliver service under this proposal and any resulting contract remains our property, solely for the use of our employees. Such equipment is not considered as part of the elevator. If the contract or subsequent maintenance service is terminated for any reason, we will be given access to the premises to remove such equipment, including the resident software, at our expense. All software supplied with the elevator is licensed to you or your successors but only for use with, and for operation of this elevator. 10. In the event the transactions contemplated hereunder are restricted by U.S. Government or other applicable laws and regulations, including but not limited to those designating certain parties as "denied", "restricted" or similarly ineligible to do business with U.S. entities, this agreement will be deemed void and Customer shall pay Otis all sums owed for the goods and services that may have been provided up to such time according to the rates contained in this agreement. 11. Our quoted price is based on an initial payment equaling fifty percent (50%) of contract award. This amount, PLUS a fully executed subcontract must be received prior to releasing equipment for manufacturing or scheduling well-hole drilling. Please see Schedule of Values Below. 12. Monthly progress payments shall include the value of work performed and materials stored on or offsite. You agree to make progress payments for any work performed prior to final execution of the contract and/or the submission of any required documents other than those required for payment applications. AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 9 of 23 Attachment number 1Page 33 of 57 10 13. Final payment shall be due thirty (30) days after final acceptance of the elevator installation, otherwise all warranties and New Installation Service (NIS) shall be suspended. We must be paid ninety-five percent (95%) of the final contract price prior to scheduling the state inspection and turnover of the elevator equipment. 14. Otis will not agree to any language referencing or implying “pay when paid”. This contract is between Otis Elevator and Contractor. Payment schedule shall not be contingent upon Contractor’s ability to be paid by others or any other factor or event not described above. 15. Fully executed change orders must be received prior to Otis performing any additional work outside the scope of the base contract. Otis will not accept oral or written “directives to proceed” without a fully executed and agreed-upon change order. 16. All change orders must be approved prior to scheduling final inspection of elevator. 17. Change orders will be stated price (lump sum). In the event a stated price cannot be calculated, hourly rates for Time and Material (T/M) are below. Per Man Regular time hourly rate: $105.00 Overtime hourly rate: $210.00 18. Contractor will communicate to Otis supervision who the signatories and/or titles, roles and positions are which are authorized to sign time tickets on-site that will be used as support documentation for T/M change orders. Work cannot commence or continue until a designated signatory signs the document. 19. All current inspection fees are included for a final inspection. Should re-inspection be required because of work that is not our responsibility, you will be responsible for the cost of re-inspection and remobilization for Otis personnel. 20. If we are requested to operate the elevator for other trades or perform labor outside of the scope of this work, it shall be performed in accordance with our normal hourly labor rates. 21. Should any elevator be required for use before substantial completion, others shall provide without expense to Otis Elevator Company, if required, temporary car enclosures, requisite guards or other protection for elevator hoistway openings,mainline switch with wiring, necessary power, signaling devices, lights in car and elevator operators together with any other special labor or equipment needed to permit this temporary usage. 22. Otis Elevator Company shall be reimbursed at our standard billing rates time and material expenses associated with the additional inspection and clean-up required for temporary use. Otis Elevator Company will be reimbursed at a rate of $45.00 per day per elevator (traction elevator) and $30.00 per day per elevator (hydraulic elevator) for temporary usage of the elevator system. It is agreed that the general contractor will be invoiced directly by the state for its governing re- inspection fee for temporary usage of the elevator(s). Otis shall also be reimbursed for any additional labor and material that is not part of the permanent elevator installation that is required to provide temporary elevator service. In addition, Otis Elevator Company’s temporary acceptance form shall be executed before any elevator is placed in temporary service, and the cost of power and operation, maintenance of the equipment and rehabilitation of equipment shall be paid for by others. 23. When an elevator is used for temporary service, the completion date may, as a result of the temporary service, be extended by Otis Elevator Company. Otis Elevator Company shall provide notice of the extension at the time the elevator is made available for the temporary service. 24. You agree to pursue and schedule the work by other trades in a timely manner so as to not interrupt our work. Should our crew(s) have to de-mobilize from the job due to delays in work by others not in our contract, we shall be entitled to a re-mobilization charge of Two-Thousand ($2,000) Dollars. We shall also extend the stated schedule to the extent that we are delayed. AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 10 of 23 Attachment number 1Page 34 of 57 11 Preparatory Work By Others The following items must be performed or furnished at no cost to Otis Elevator Company (“Otis”) by the Owner or General Contractor or their agents in accordance with governing codes. The price and installation schedule of Otis Elevator Company is based on these job-site conditions existing at the beginning and during installation of the elevator equipment. Please refer to our Installation Handbook for details and dimensions for the following items. All work to be performed per the latest revision of the applicable national code and/or local code. General Prep/Work 1. Provide any cutting, including cutouts to accommodate machine-room piping, hall-signal fixtures, patching, and painting of walls; floors, or partitions together with finish painting of entrance doors and frames, if required. 2. Provide the use of a crane to place the hydraulic elevator cylinder assemblies in the hoistway prior to enclosing the top of the hoistway. For the Gen2 Traction elevators, provide the use of a crane suitable for hoisting a load of up to 3500 lbs. (1588 kg.) for hoisting the integrated machine and bedplate structure and the controller into place prior to enclosing the hoistway. Provide adequate OSHA approved fall protection at the opening of the top of the hoistway on the roof. Fall protection must be adequate for two people and be in place prior to the hoisting of elevator equipment. 3. Provide secure, on-site storage area for elevator equipment as follows: dry and enclosed, provides roll-able access to the elevator hoistway at the ground level, located within 100 feet of the hoistway and is larger than 25 x 20 feet (7620 mm X 6096 mm) per unit. Any warranties provided by Otis for elevator equipment are null and void if equipment is stored in a manner other than a dry enclosed building structure. 4. We require suitable tractor-trailer access to the building for unloading of material. In addition, we need rollable access from unloading point to from storage and storage to hoistway area. 5. If you are not ready to accept delivery of the material on the date the machine room is to be ready, you shall give us sufficient notice of a local point where you will accept delivery, and be responsible for all monthly storage fees. An extra charge will be assessed for any double handling or re- transportation of elevator material required by the general contractor/owner or agent thereof. 6. Provide sufficient on-site refuse containers for the proper disposal of elevator packaging material. Should sufficient refuse containers not be provided, disposal of packaging material shall become the responsibility of the owner. Hoistway and Pit Prep/Work 7. Prior to the start of installation, provide a dry, properly framed, enclosed and vented hoistway in accordance with all applicable codes. This includes that One front entrance wall, at the main landing, is not to be constructed until after all elevator material is located in the hoistway. Remaining front entrance walls are not to be constructed until after door frames and sills are in place. If front walls are poured concrete bearing walls, rough openings are to be provided to accept entrance frames and filled in after frames are set. Rough opening size per Otis layouts. Prior to the elevators being turned over, all entrance walls must be installed and rough openings filled in complete. 8. Provide a clear plumb hoistway with variations from the size shown on the Otis layout not to exceed 1” (25mm) at the first 20 floors and 1/32” (8mm) increase for each additional floor up to a maximum of 2” (52mm) and not less than the clear dimensions shown on the Otis layout. 9. If the floor-to-floor height exceeds the maximum bracket spacing allowed by Otis equipment, Otis requires some form of steel support to properly attach our guide rail brackets. The maximum allowed bracket spacing is indicated in the rail force and bracket detail table on elevator layout. Otis agrees to provide guidance on this matter at the appropriate time. If rail bracket embedded plates or inserts are AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 11 of 23 Attachment number 1Page 35 of 57 12 provided by Otis they shall be installed by others in accordance with Otis documentation and instructions. You must furnish adequate rail-bracket supports and bracket spacing as required by governing code, from pit floor to top of hoistway. For steel or wood frame construction, adequate backing for a rail bracket to be installed not less than 10’3”(3225 mm) or more than 11’3” (3429 mm) from the top landing. Furnish separator beams where required. Rail-bracket attachment supports must be exposed and flush with the clear hoistway line. If rail-bracket inbeds or inserts are provided by Otis, they shall be installed by others in accordance with Otis’ documentation and instruction. 10. For Hydraulic Elevators furnish a dry pit reinforced to sustain vertical forces on car rails and impact loads on cylinder head(s) and buffer(s). The pit must be dry and clean. The elevator pit may not have a floor drain/sump pump connected directly to a storm drain or sewer. Otis recommends that the owner verify the system is in compliance with all applicable laws. For Traction Elevators Provide a pit floor designed to sustain vertical forces (forces based on safety impact) on car and counterweight rails as shown in the rail force and bracket spacing table and impact loads on car and counterweight buffers as shown in the pit plan view of the elevator layout. The pit must be dry and clean. The elevator pit must have a floor drain or sump pump to prevent the accumulation of water, but not connected directly to a storm drain or sewer. The floor drain or sump pump should lead to a holding tank rather than a sewer or uncontained area. Location to be coordinated with Otis to avoid all elevator components and access areas. Otis recommends that the owner verify the drain or sump pump system is in compliance with all applicable laws. 11. Provide and install a fixed vertical iron ladder in each pit as required by governing code and located per Otis layouts or as coordinated with Otis personnel. Ladder width and projection from wall per local code. If pit depth is greater than 9’ 10” (3000mm) [13’ 9” with no floor below bottom landing], a pit access door is required. 12. For purposes of installing the IMBS system and belting up the Gen2 Elevators, it is a requirement that you construct for Otis a temporary work platform at the top landing of the hoistway(s). The furnishing, installation, and removal of this temporary platform is to be provided by others in accordance with governing codes and regulations and is not included in the elevator’s scope of work. The platform is to be located at the top landing of the hoistway(s) and shall be securely fastened to the building structure. The platform shall be designed for not less than 50-psf uniform live load and a concentrated point load of 500 lb. The platform shall be installed complete with guardrails at the perimeter of any opening in the platform.The working surface of the platform shall have within easy reach secure anchorage points for attachment of fall arrest lifelines, lanyards, or deceleration devices. The design and installation of the temporary platform shall be in accordance with the applicable provisions of all federal, state and local codes and regulations including but not limited to the latest amendments of the American National Standards Institute, Inc. (ANSI), the Occupational Safety and Health Act (OSHA), and the State Building Code in effect in the state in which the elevator is being installed.Otis has a temporary work platform design that meets these requirements. Request a copy of Otis drawing AAA27CR for details. 13. Install a permanent light fixture in each elevator pit with illumination of not less than 100 lx (10 fc) as measured at the pit floor. The light bulb(s) shall be externally guarded to prevent contact and accidental breakage. The light switch shall be so located as to be accessible from the pit ladder or access door. 14. If pit depth is greater than 8’ 3” a platform for accessing the equipment on the underside of the car is required. The platform shall: a. Be coordinated with Otis personnel to interface with Otis’ elevator equipment. b. Maintain clearances and refuge spaces as defined in all applicable codes. AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 12 of 23 Attachment number 1Page 36 of 57 13 c. Be equipped with OSHA compliant guardrails when a fall hazard exists. d. In seismic risk zone, comply with all applicable building code requirements to restrain it due to ground acceleration during an earthquake e. Be designed and installed to support without permanent deformation on the following loads: Minimum of 80 lb./ft 2 (390kg/390kg/m2) evenly distributed over the entire servicing platform area, minimum of 225 lb. (100kg) concentrated load on any 3 in.2 (2000 mm 2) area. 15. Glass used in hoistway construction must block 98% or more of incident full-spectrum ultraviolet radiation for the full height of the hoistway. 16. For the Holed Hydraulic Elevators you must provide pit-floor cutout 30” x 30”, location as required by Otis layout, to accommodate cylinder assembly. Provide patching of pit floor after setting of cylinder assembly to accommodate a watertight condition. Standard water connections (if necessary) for equipment and outlet line must be provided for discharging excess water while sinking cylinder well. Furnish water for sinking cylinder well at no cost to Otis. You must provide removal of spoils from well-hole excavation. Hydraulic Oil lines will be run above ground. 17. For protection from falls and as required by OSHA, (OSHA)1926.502 B) (1-3)a freestanding removable barricade at each hoistway opening at each floor.Barricades shall be 42” (1067mm) high, with mid-rail and kick board, and withstand 200 lbs. of vertical and horizontal pressure. 18. For protection from falling objects and as required by OSHA (OSHA) 1926.502(j) hoistway protection from falling debris and other trades materials by either full entrance screening/mesh in front of all elevator entrances or by providing secured/controlled access to all elevator lobbies (lock and key) with posted Notice “only elevator personnel beyond this protection.” These can be integrated systems. Hoistway barricades and screening shall be constructed and removed by others. 19. Provide a properly framed and enclosed legal hoistway in accordance with all applicable codes that is ready for uninterrupted use by Otis. Specifically, provide a hoistway that complies with the following requirements: Dry, Plumb within +1 inch and –0 inches, Vented as required by governing code authority, Inserts, imbeds or rail fastening installed, Steel safety beam in place positioned side to side as shown on Otis layout, Otis/OSHA compliant barricades in place. Freestanding and removable barricades at each hoistway opening at each floor. Barricades shall be 42” high, have center board and kick board, and withstand 200lbs. of side pressure. 20. Furnish hoistway walls designed and constructed in accordance with the required fire rating (including those places where elevator fixture boxes and rail-bracket fastenings penetrate the hoistway walls). The hoistway walls are to include adequate fastening to hoistway entrance assemblies. One front entrance wall, at the main landing, is not to be constructed until after all elevator material is located in the hoistway. Remaining front entrance walls are not to be constructed until door frames and sills are in place. If front walls are poured concrete weight bearing walls, rough openings are to be provided to accept entrance frames and filled in after frames are set. Rough opening size per Otis layouts. 21. Provide plumb vertical surfaces for entrance-sill supports, one above the other, and square with the hoistway. For 4’-0” (1220 mm) and 4’-6” (1372 mm) two-speed door arrangements on 4500 lb. (2041 kg) and 5000 lb. (2270 kg) cars a hoistway attachment point is required for an auxiliary support bracket under the sill assembly in the center of the clear door opening. Finished floor and grout, if required, between door frames to sill line. A horizontal support is to be provided 12” (305 mm) above the clear opening at each landing to support the doorframe assembly. 22. Provide and install a safety beam capable of withstanding a maximum net live load of 5000 lb. (2268 kg). Otis requires 2” clear above the beam. Beam must be removed before car is placed in operation if it infringes on required clearance. Machine Room 23. Provide a suitable control room(s)/space(s) with access and ventilation in accordance with all applicable codes and regulations. The control room(s)/space(s) shall be maintained at a temperature between 32qF (0qC) and 104qF (40qC) to be measured 6 feet (1830 mm) above the floor and 1 foot (305 mm) out from the front center of the car controller(s). Relative humidity is AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 13 of 23 Attachment number 1Page 37 of 57 14 not to exceed 95% non-condensing. Provide ventilation to suit Otis heat release amounts as shown on the Otis Confirmation of Power Supply form. Local codes may require tighter temperature ranges and higher ventilation levels, please check with your local code authority for the exact requirements in your area. If your control room(s)/Space(s) temperatures exceed these requirements, contact your local Otis sales representative for assistance. 24. Provide illumination of control room(s)/space(s) of not less than 200 LUX (19 FC) as measured at floor level. Light switch is to be located within 18” (157 mm)to the lock-jamb side of the access door to of the control room/space. 25. Provide control room(s)/space(s) with self-closing and self-locking doors with group 2 locking device. In addition, ensure that all air gaps around the doors are sealed. Fire Prevention Prep/Work 26. Provide hoistway walls designed and constructed in accordance with the required fire rating (including those places where elevator fixture boxes, rail bracket fastenings, and any other penetration into the hoistway walls). 27. Provide smoke detectors, located as required, with wiring from the sensing devices to the controller(s) designated by Otis. a. For each group of elevators, provide a normally closed contact representing the smoke detector at the designated return landing. b. For each group of elevators, provide a normally closed contact representing all smoke detectors located in lobbies, hoistways, or control rooms/spaces, but not the smoke detector at the designated return landing (see above) or the smoke detectors as described in i. & ii. below. i. If a smoke detector is located in the hoistway at or below the lower of the two recall landings, it shall be wired to activate the same normally closed contact as the smoke detector located in the lobby at the lower of the two recall landings. ii. If the control room(s)s/space(s) are locate at the designated return landing, the smoke detectors located therein shall be wired to activate the same normally closed contact as the smoke detector at the designated landing. c. Requirements for intermittently illuminating the fire hat visual signal in the car operating panel. i. For a single unit or for a group of elevators having one common control room/space and one common hoistway, provide one additional normally closed contact representing the control room/space and hoistway smoke detectors. ii. If the group contains more than one hoistway and hoistway smoke detectors are installed, or if the group has more than one control room/space, provide one normally closed contact for each elevator. The contact is to represent the smoke detector in the control room/space for that particular elevator, and any smoke detectors in the hoistway containing that particular elevator. 28. If sprinklers are installed in the hoistway(s), control room(s)/space(s), or machine space(s), a means to automatically disconnect the main line power supply of the affected elevator and any other power supplies used to move the elevator upon or prior to the application of water is required. This automatically controlled mainline disconnect must be provided with all associated wiring and conduit to the controller. AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 14 of 23 Attachment number 1Page 38 of 57 15 29. Provide control room(s)/space(s) and door to code compliant fire-resistive construction. 30. Provide a fire extinguisher in all control room(s)/space(s) and/or machine room(s). Electrical Requirements 31. Prior to the start of installation provide a permanent three (3) phase electrical feeder system with a separate equipment grounding conductor terminating in the control room/space, located per Otis layout. Feeder conductors and grounding conductor sized according to elevator current characteristics as shown on the Otis Confirmation of Power Supply form. A fused disconnect switch or circuit breaker capable of being locked in the open position, for each elevator per the National Electrical Code (ANSI/NFPA 70) or Canadian Electrical Code (C22.1) with feeder or branch wiring to controller [NEC 620-51] or [CEC Rule 28-106]. Fuses are to be current limiting class RK1 or equivalent. Circuit breakers are to have current limiting characteristics equivalent to class RK1 fuses. Fuses or circuit breakers are to be time delay to cover the full load up accelerating current as listed in the Otis Confirmation of Power Supply form. The disconnecting means required by the National Electrical Code shall be provided with all associated wiring and conduit to the controller. Size of main contacts to suit elevator power characteristics. 32. If three (3) phase power is not available at the start of installation, a temporary single phase 220V, 55 ampere power supply with fused disconnect or circuit breaker for each elevator and available in the control room(s)/space(s) can be provided.This option requires additional cost and authorization from the Otis construction superintendent. 33. Provide a dedicated 125-volt, 15-ampere single-phase branch circuit; with a fused disconnect switch or circuit breaker. This disconnect or breaker shall be capable of being locked in the open position and located per the Otis layout. This branch circuit supplies the car lights, car top receptacle, auxiliary lighting power source, and ventilation on each car in compliance with the National Electrical Code [NEC 620-53] or Canadian Electrical Code [CEC Rule 28-106]. 34. Provide a dedicated 125 volt, 15 ampere single-phase power supply with a fused SPST disconnect switch or circuit breaker for remote monitoring. This disconnect or breaker shall be capable of being locked in the open position and located per the Otis layout. 35. All 125 volt, 15 or 20 ampere single-phase receptacles installed in pits, machine spaces, control room(s)/space(s) shall be of the ground-fault circuit-interrupter type. A dedicated single-phase receptacle supplying a permanently installed pit sump pump shall not require GFCI protection. 36. Provide electric power for lights, tools, welding, hoisting, etc. during installation with sufficient power for starting, testing and adjusting the elevator. 37. Provide one (1) dedicated outside telephone line, per group, to the elevator control room/space, and terminated at the controller designated by the Otis construction superintendent. 38. In areas under the jurisdiction of ASME A17.1a-2002 where elevator travel is greater than or equal to 60 ft, provide two-way voice communications means that shall enable emergency personnel within the building to establish communications to each car individually without intervention by a person within the car. The communication means shall override communications to the outside of the building and once established shall only be terminated by emergency personnel outside the car. Refer to ASME A17.1a-2002, section 2.27.1.1.4 for exact requirements. 39. For elevators having an intercom, provide a separate 120 volt, 15 ampere, single phase power supply with fused SPST disconnect switch or circuit breaker, located as required for inter- communicating system power supply. Circuit to be arranged for feeding from the building AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 15 of 23 Attachment number 1Page 39 of 57 16 emergency lighting supply if provided. Conduit and wiring for remotely located inter- communicating stations. 40. For installations having a lobby panel, provide wiring and conduit to panels located away from the elevator hoistway for remote elevator control/indicator panels. 41. For installations having emergency (standby) power, provide the emergency (standby) power unit and means for starting it. The emergency (standby) power unit shall deliver to the elevator via disconnect switches in the control room/space, sufficient power to operate one or more elevators at a time at full rated speed, and rated load. An automatic Power Transfer Switch for each power feeder to monitor both normal & emergency (standby) power conditions & to perform the transfer from one to the other. Switch to have 2 sets of normally closed dry contacts, one to be open when the switch is in the emergency (standby) power position; the other to open upon initiation of power transfer & to close when transfer is complete. Switch to have an inhibit function which will delay transfer to normal and/or emergency (standby) power by an adjustable period of 0 – 300 seconds. Switch shall have a phase monitor feature, which prohibits the transfer of power between “live” sources unless the sources are in phase with each other. If a shunt trip device is provided, an additional normally closed contact, with all associated wiring & conduit to the controller, is required from the emergency (standby) power source. The emergency (standby) power unit must be capable of absorbing regenerative power per elevator in accordance with ANSI/NFPA 70 requirement 620.91. Emergency (standby) power system shall be connected to 125-volt power circuit as noted in note A.2. of the Power Confirmation for the branch circuit supplying the car lights, car top receptacle, auxiliary car lighting power source and car ventilation 42. For Hydraulic Elevators with a Battery-Powered Emergency Return Unit (ERU) - Provide the disconnecting means required by the National Electrical Code (NEC) with an auxiliary contact and wiring to the controller. The auxiliary contact is to be positively open when the main disconnecting means is open. The auxiliary contact shall cause the ERU power source to be disconnected from its load when the disconnecting means is in the open position. Size of main contacts to suit elevator power characteristics. Heat sensors, when used to automatically disconnect the mainline power supply prior to the application of water from sprinklers, shall be provided with a normally closed contact with wiring from the sensing device to a controller designated by Otis. The normally closed contact shall be closed when the heat sensor is not activated and shall be open when the heat sensor is activated. Control Room/Space and Machine Space Prep/Work 43. Maintain the temperature at the top of the hoistway (machine space) between 32º F (0º C) and 113º F (45º C). Relative humidity not to exceed 95% non-condensing. Provide ventilation to suit Otis heat release amounts as shown on the Otis Confirmation of Power Supply form. If your machine space temperatures exceed these requirements, contact your Otis sales representative. 44. Install a permanent light fixture at the top of the hoistway (machine space) of not less 200-lux (19fc) as measured at the level of the standing surface at the level of the standing surface on the car when the elevator is at the top landing. Light switch is to be located per the Otis layout. 45. Location of steel or concrete supports in the hoistway overhead (machine space) for the elevator beams and channels as required by elevator contractor. 46. You agree to indemnify and save Otis harmless against any and all liability and costs arising out of your failure to carry out any of the foregoing requirements. AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 16 of 23 Attachment number 1Page 40 of 57 4GHGTVQ#5/'#ÄUGEVKQPHQTGZCEVTGSWKTGOGPVU VJGQWVUKFGQHVJGDWKNFKPICPFQPEGGUVCDNKUJGFUJCNNQPN[DGVGTOKPCVGFD[GOGTIGPE[RGTUQPPGNQWVUKFGVJGECT VYQÄYC[XQKEGEQOOWPKECVKQPUOGCPUVJCVUJCNNGPCDNGGOGTIGPE[RGTUQPPGNYKVJKPVJGDWKNFKPIVQGUVCDNKUJEQOOWPKECVKQPUVQ ':24'55&4#9 16+5'.'8#614%1/2#0;%#..4+)*654'5'48'&7027$.+5*'&914- 241/26.;4'6740'&6116+5#0&6*#610&'/#0&+6#0%12+'59+..$'2#469+6*1766*'24+1494+66'0%105'061(16+59+..$'4'241&7%'&14&+5%.15'&+09*1.'14+06*#60'+6*'4+60146*'+0(14/#6+10+6%106#+05+69+..$'75'&10.;(141410$'*#.(1(16+5&'.+8'4'&6116*'45106*'':24'55%10&+6+106*#62412'46;1(16+5'.'8#614%1/2#0; 16+5+6+56*+5914-#0&6*'+0(14/#6+10+6%106#+05#4'6*' OWUVDGRTQXKFGFYKVJCNNCUUQEKCVGFYKTKPICPFEQPFWKVVQVJGEQPVTQNNGT CRRNKECVKQPQHYCVGTKUTGSWKTGF WPNGUURTQJKDKVGFD[NQECNEQFG6JKUCWVQOCVKECNN[EQPVTQNNGFOCKPNKPGFKUEQPPGEV URCEG UCOGCPUVQCWVQOCVKECNN[FKUEQPPGEVVJGOCKPNKPGRQYGTUWRRN[QHVJGCHHGEVGFGNGXCVQTRTKQTVQVJG +HURTKPMNGTUCTGKPUVCNNGFKPVJGJQKUVYC[ UEQPVTQNTQQO UURCEG UQTOCEJKPGOQWPVKPIUVTWEVWTG VJGJQKUVYC[EQPVCKPKPIVJCVRCTVKEWNCTGNGXCVQTTGRTGUGPVVJGUOQMGFGVGEVQTKPVJGEQPVTQNTQQOURCEGHQTVJCVRCTVKEWNCTGNGXCVQTCPFCP[UOQMGFGVGEVQTUKP JCUOQTGVJCPQPGEQPVTQNTQQOURCEGRTQXKFGQPGPQTOCNN[ENQUGFEQPVCEVHQTGCEJGNGXCVQT6JGEQPVCEVKUVQKK+HVJGITQWREQPVCKPUOQTGVJCPQPGJQKUVYC[CPFJQKUVYC[UOQMGFGVGEVQTUCTGKPUVCNNGFQTKHVJGITQWR FGVGEVQTUJQKUVYC[RTQXKFGQPGCFFKVKQPCNPQTOCNN[ENQUGFEQPVCEVTGRTGUGPVKPIVJGEQPVTQNTQQOURCEGCPFJQKUVYC[UOQMG K(QTCUKPINGWPKVQTHQTCITQWRQHGNGXCVQTUJCXKPIQPGEQOOQPEQPVTQNTQQOURCEGCPFQPGEQOOQPCRRN[ E4GSWKTGOGPVUHQTKPVGTOKVVGPVN[KNNWOKPCVKPIVJGHKTGJCVXKUWCNUKIPCNKPVJGECTQRGTCVKPIRCPGNGKVJGTKQTKK NCPFKPIVJGTGKPUJCNNDGYKTGFVQCEVKXCVGVJGUCOGPQTOCNN[ENQUGFEQPVCEVCUVJGUOQMGFGVGEVQTCVVJGFGUKIPCVGFKK+HVJGEQPVTQNTQQO UURCEG UCTGNQECVGFCVVJGFGUKIPCVGFTGVWTPNCPFKPIVJGUOQMGFGVGEVQTUNQECVGF VJGVYQTGECNNNCPFKPIUYKTGFVQCEVKXCVGVJGUCOGPQTOCNN[ENQUGFEQPVCEVCUVJGUOQMGFGVGEVQTNQECVGFKPVJGNQDD[CVVJGNQYGTQHK+HCUOQMGFGVGEVQTKUNQECVGFKPVJGJQKUVYC[CVQTDGNQYVJGNQYGTQHVJGVYQTGECNNNCPFKPIUKVUJCNNDG CDQXGQTVJGUOQMGFGVGEVQTUCUFGUETKDGFKPK KK$GNQY NQDDKGUJQKUVYC[UQTEQPVTQNTQQO UURCEG UDWVPQVVJGUOQMGFGVGEVQTCVVJGFGUKIPCVGFTGVWTPNCPFKPI UGGD(QTGCEJITQWRQHGNGXCVQTURTQXKFGCPQTOCNN[ENQUGFEQPVCEVTGRTGUGPVKPICNNUOQMGFGVGEVQTUNQECVGFKP FGUKIPCVGFTGVWTPNCPFKPIC(QTGCEJITQWRQHGNGXCVQTURTQXKFGCPQTOCNN[ENQUGFEQPVCEVTGRTGUGPVKPIVJGUOQMGFGVGEVQTCVVJG FGUKIPCVGFD[1VKU2TQXKFGUOQMGFGVGEVQTUNQECVGFCUTGSWKTGFYKVJYKTKPIHTQOVJGUGPUKPIFGXKEGUKPVQVJGEQPVTQNNGT U RNCEGUYJGTGGNGXCVQTHKZVWTGDQZGUTCKNDTCEMGVHCUVGPKPIUCPFCP[QVJGTRGPGVTCVKQPKPVQVJGJQKUVYC[YCNNU 2TQXKFGJQKUVYC[YCNNUFGUKIPGFCPFEQPUVTWEVGFKPCEEQTFCPEGYKVJVJGTGSWKTGFHKTGTCVKPI KPENWFKPIVJQUG (KTG2TGXGPVKQP2TGR9QTM EJCPPGNUCUTGSWKTGFD[GNGXCVQTEQPVTCEVQT.QECVKQPQHUVGGNQTEQPETGVGUWRRQTVUKPVJGJQKUVYC[QXGTJGCF OCEJKPGURCEGHQTVJGGNGXCVQTDGCOUCPF KUVQDGNQECVGFKPVJGJQKUVYC[RGTVJG1VKUNC[QWVCUOGCUWTGFCVVJGNGXGNQHVJGUVCPFKPIUWTHCEGQPVJGECTYJGPVJGGNGXCVQTKUCVVJGVQRNCPFKPI.KIJVUYKVEJ+PUVCNNCRGTOCPGPVNKIJVHKZVWTGCVVJGVQRQHVJGJQKUVYC[ OCEJKPGURCEGQHPQVNGUUVJCPNZ=HE? TGSWKTGOGPVUEQPVCEV[QWTNQECN1VKUUCNGUTGRTGUGPVCVKXGHQTCUUKUVCPEGUJQYPQPVJG1VKU%QPHKTOCVKQPQH2QYGT5WRRN[HQTO+H[QWTOCEJKPGURCEGVGORGTCVWTGUGZEGGFVJGUG %?4GNCVKXGJWOKFKV[PQVVQGZEGGFPQPÄEQPFGPUKPI2TQXKFGXGPVKNCVKQPVQUWKV1VKUJGCVTGNGCUGCOQWPVUCU /CKPVCKPVJGVGORGTCVWTGCVVJGVQRQHVJGJQKUVYC[ OCEJKPGURCEGDGVYGGP(=%?CPF(= CFFKVKQPGPUWTGVJCVCNNCKTICRUCTQWPFVJGFQQTUCTGUGCNGF KGVJTGUJQNFYGCVJGTUVTKRRKPIGVE2TQXKFGEQPVTQNTQQO UURCEG UYKVJUGNHÄENQUKPICPFUGNHÄNQEMKPIFQQTUYKVJITQWRNQEMKPIFGXKEG+P TQQOURCEG .KIJVUYKVEJKUVQDGNQECVGFYKVJKP=OO?VQVJGNQEMÄLCODUKFGQHVJGCEEGUUFQQTQHVJGEQPVTQN2TQXKFGKNNWOKPCVKQPQHEQPVTQNTQQO UURCEG UQHPQVNGUUVJCPNZ=HE?CUOGCUWTGFCVHNQQTNGXGN NQECN1VKUUCNGUTGRTGUGPVCVKXGHQTCUUKUVCPEGTGSWKTGOGPVUKP[QWTCTGC+H[QWTEQPVTQNTQQO UURCEGU UVGORGTCVWTGUGZEGGFVJGUGTGSWKTGOGPVUEQPVCEV[QWTVGORGTCVWTGTCPIGUCPFJKIJGTXGPVKNCVKQPNGXGNURNGCUGEJGEMYKVJ[QWTNQECNEQFGCWVJQTKV[HQTVJGGZCEVTGNGCUGCOQWPVUCUUJQYPQPVJG1VKU%QPHKTOCVKQPQH2QYGT5WRRN[HQTO.QECNEQFGUOC[TGSWKTGVKIJVGTVJGECTEQPVTQNNGT U4GNCVKXGJWOKFKV[KUPQVVQGZEGGFPQPÄEQPFGPUKPI2TQXKFGXGPVKNCVKQPVQUWKV1VKUJGCV ( %VQDGOGCUWTGFHGGV=OO?CDQXGVJGHNQQTCPFHQQV=OO?QWVHTQOVJGHTQPVEGPVGTQH CPFTGIWNCVKQPU6JGEQPVTQNTQQO UURCEG UUJCNNDGOCKPVCKPGFCVCVGORGTCVWTGDGVYGGP( %CPF 2TQXKFGCUWKVCDNGEQPVTQNTQQO UURCEG UYKVJCEEGUUCPFXGPVKNCVKQPKPCEEQTFCPEGYKVJCNNCRRNKECDNGEQFGU %QPVTQN4QQO5RCEGCPF/CEJKPG5RCEG2TGR9QTM CTGCOKPKOWOQHNDU=MI?EQPEGPVTCVGFNQCFQPCP[KP=OO? GXGPN[FKUVTKDWVGFQXGTVJGGPVKTGUGTXKEKPIRNCVHQTOCTGCYKVJCCPFCOKPKOWOQHNDHV=MIO? G$GFGUKIPGFCPFKPUVCNNGFVQUWRRQTVYKVJQWVRGTOCPGPVFGHQTOCVKQPQPVJGHQNNQYKPINQCFUNDU=MI?CEEGNGTCVKQPFWTKPICPGCTVJSWCMG F+PUGKUOKETKUM\QPGEQORN[YKVJCNNCRRNKECDNGDWKNFKPIEQFGTGSWKTGOGPVUVQTGUVTCKPKVFWGVQITQWPFE$GGSWKRRGFYKVJ15*#EQORNKCPVIWCTFTCKNUYJGPCHCNNJC\CTFGZKUVU D/CKPVCKPENGCTCPEGUCPFTGHWIGURCEGUCUFGHKPGFKPCNNCRRNKECDNGEQFGU C$GEQQTFKPCVGFYKVJ1VKURGTUQPPGNVQKPVGTHCEGYKVJ1VKUGNGXCVQTGSWKROGPVECTKUTGSWKTGF6JGRNCVHQTOUJCNN+HRKVFGRVJKUITGCVGTVJCP=OO?CRNCVHQTOHQTCEEGUUKPIVJGGSWKROGPVQPVJGWPFGTUKFGQHVJG 6JGNKIJVUYKVEJUJCNNDGUQNQECVGFCUVQDGCEEGUUKDNGHTQOVJGRKVNCFFGTQTCEEGUUFQQT OGCUWTGFCVVJGRKVHNQQT6JGNKIJVDWND UUJCNNDGGZVGTPCNN[IWCTFGFVQRTGXGPVEQPVCEVCPFCEEKFGPVCNDTGCMCIG+PUVCNNCRGTOCPGPVNKIJVHKZVWTGKPVJGGNGXCVQTRKVYKVJKNNWOKPCVKQPQHPQVNGUUVJCPNZ=HE?CU TGSWKTGF ITGCVGTVJCPÄ=OO?==OO?YKVJPQHNQQTDGNQYDQVVQONCPFKPI?CRKVCEEGUUFQQTKUNC[QWVUQTCUEQQTFKPCVGFYKVJ1VKURGTUQPPGN.CFFGTYKFVJCPFRTQLGEVKQPHTQOYCNNRGTNQECNEQFG+HRKVFGRVJKU2TQXKFGCPFKPUVCNNCHKZGFXGTVKECNKTQPNCFFGTKPGCEJRKVCUTGSWKTGFD[IQXGTPKPIEQFGCPFNQECVGFRGT1VKU DGKPIVWTPGFQXGTCNNGPVTCPEGYCNNUOWUVDGKPUVCNNGFCPFTQWIJQRGPKPIUHKNNGFKPEQORNGVGGPVTCPEGHTCOGUCPFHKNNGFKPCHVGTHTCOGUCTGUGV4QWIJQRGPKPIUK\GRGT1VKUNC[QWVU2TKQTVQVJGGNGXCVQTUCTGKPRNCEG+HHTQPVYCNNUCTGRQWTGFEQPETGVGDGCTKPIYCNNUTQWIJQRGPKPIUCTGVQDGRTQXKFGFVQCEEGRVNQECVGFKPVJGJQKUVYC[4GOCKPKPIHTQPVGPVTCPEGYCNNUCTGPQVVQDGEQPUVTWEVGFWPVKNCHVGTFQQTHTCOGUCPFUKNNU1PGHTQPVGPVTCPEGYCNNCVVJGOCKPNCPFKPIKUPQVVQDGEQPUVTWEVGFWPVKNCHVGTCNNGNGXCVQTOCVGTKCNKU VJGQYPGTXGTKH[VJGFTCKPQTUWORRWORU[UVGOKUKPEQORNKCPEGYKVJCNNCRRNKECDNGNCYUQTUWORRWORUJQWNFNGCFVQCJQNFKPIVCPMTCVJGTVJCPCUGYGTQTWPEQPVCKPGFCTGC1VKUTGEQOOGPFUVJCVQTUGYGT.QECVKQPVQDGEQQTFKPCVGFYKVJ1VKUVQCXQKFCNNGNGXCVQTEQORQPGPVUCPFCEEGUUCTGCU6JGHNQQTFTCKP HNQQTFTCKPQTUWORRWORVQRTGXGPVVJGCEEWOWNCVKQPQHYCVGTDWVPQVDGEQPPGEVGFFKTGEVN[VQCUVQTOFTCKPEQWPVGTYGKIJVDWHHGTUCUUJQYPKPVJGRKVRNCPXKGY6JGRKVOWUVDGFT[CPFENGCP6JGGNGXCVQTRKVOWUVJCXGC EQWPVGTYGKIJVTCKNUCUUJQYPKPVJGTCKNHQTEGCPFDTCEMGVURCEKPIVCDNGCPFKORCEVNQCFUQPECTCPF 2TQXKFGCRKVHNQQTFGUKIPGFVQUWUVCKPXGTVKECNHQTEGU HQTEGUDCUGFQPUCHGV[KORCEVQPECTCPF CPFTGOQXGFD[QVJGTU MKEMDQCTFCPFYKVJUVCPFNDU=MI?QHUKFGRTGUUWTG*QKUVYC[DCTTKECFGUUJCNNDGEQPUVTWEVGFOCKPVCKPGF DCTTKECFGCVGCEJJQKUVYC[QRGPKPICVGCEJHNQQT$CTTKECFGUUJCNNDG=OO?JKIJJCXGEGPVGTDQCTFCPF 2TQXKFGIWCTFKPICPFRTQVGEVKQPQHVJGJQKUVYC[FWTKPIEQPUVTWEVKQP2TQXKFGCHTGGUVCPFKPITGOQXCDNG ###%4HQTFGVCKNU1VKUJCUCVGORQTCT[YQTMRNCVHQTOFGUKIPVJCVOGGVUVJGUGTGSWKTGOGPVU4GSWGUVCEQR[QH1VKUFTCYKPI %QFGKPGHHGEVKPVJGUVCVGKPYJKEJVJGGNGXCVQTKUDGKPIKPUVCNNGF0CVKQPCN5VCPFCTFU+PUVKVWVG+PE #05+VJG1EEWRCVKQPCN5CHGV[CPF*GCNVJ#EV 15*#CPFVJG5VCVG$WKNFKPI HGFGTCNUVCVGCPFNQECNEQFGUCPFTGIWNCVKQPUKPENWFKPIDWVPQVNKOKVGFVQVJGNCVGUVCOGPFOGPVUQH#OGTKECP 6JGFGUKIPCPFKPUVCNNCVKQPQHVJGVGORQTCT[RNCVHQTOUJCNNDGKPCEEQTFCPEGYKVJVJGCRRNKECDNGRTQXKUKQPUQHCNN CTTGUVNKHGNKPGUNCP[CTFUQTFGEGNGTCVKQPFGXKEGU6JGYQTMKPIUWTHCEGQHVJGRNCVHQTOUJCNNJCXGYKVJKPGCU[TGCEJUGEWTGCPEJQTCIGRQKPVUHQTCVVCEJGOGPVQHHCNN 6JGRNCVHQTOUJCNNDGKPUVCNNGFEQORNGVGYKVJIWCTFTCKNUCVVJGRGTKOGVGTQHCP[QRGPKPIKPVJGRNCVHQTO NQCFQHND UVTWEVWTG6JGRNCVHQTOUJCNNDGFGUKIPGFHQTPQVNGUUVJCPÄRUHWPKHQTONKXGNQCFCPFCEQPEGPVTCVGFRQKPV6JGRNCVHQTOKUVQDGNQECVGFCVVJGVQRNCPFKPIQHVJGJQKUVYC[ UCPFUJCNNDGUGEWTGN[HCUVGPGFVQVJGDWKNFKPI PQVKPENWFGFKPVJGGNGXCVQTEQPVTCEVQTUUEQRGQHYQTM VJKUVGORQTCT[RNCVHQTOKUVQDGRTQXKFGFD[QVJGTUKPCEEQTFCPEGYKVJIQXGTPKPIEQFGUCPFTGIWNCVKQPUCPFKURNCVHQTOKUVQDGEQPUVTWEVGFCVVJGVQRNCPFKPIQHVJGJQKUVYC[ UVJGHWTPKUJKPIKPUVCNNCVKQPCPFTGOQXCNQH 9JGPKPUVCNNKPIVJGGNGXCVQTGSWKROGPVWUKPIVJG1VKU(+6OGVJQFKVKUCTGSWKTGOGPVVJCVCVGORQTCT[YQTM YKVJCNNCRRNKECDNGEQFGU2TKQTVQVJGUVCTVQHKPUVCNNCVKQPRTQXKFGCFT[RTQRGTN[HTCOGFGPENQUGFCPFXGPVGFJQKUVYC[KPCEEQTFCPEG CVVJGVQRNCPFKPIVQUWRRQTVVJGFQQTHTCOGCUUGODN[DGVYGGPFQQTHTCOGUVQUKNNNKPG#JQTK\QPVCNUWRRQTVKUVQDGRTQXKFGFHQQV=OO?CDQXGVJGENGCTQRGPKPI GPVTCPEGUCPFUKNNUWRRQTVUQPGCDQXGVJGQVJGTCPFUSWCTGYKVJVJGJQKUVYC[(KPKUJHNQQTCPFITQWVKHTGSWKTGF2TQXKFGCFGSWCVGUWRRQTVCVCNNHCUVGPKPIRQKPVUQHGCEJGPVTCPEG2TQXKFGRNWODXGTVKECNUWTHCEGUHQT YKVJ1VKUFQEWOGPVCVKQPCPFKPUVTWEVKQPU+HTCKNDTCEMGVGODGFFGFRNCVGUQTKPUGTVUCTGRTQXKFGFD[1VKUVJG[UJCNNDGKPUVCNNGFD[QVJGTUKPCEEQTFCPEG FKUVCPEG1VKUCITGGUVQRTQXKFGIWKFCPEGQPVJKUOCVVGTCVVJGCRRTQRTKCVGVKOGVJGHKPKUJGFJQKUVYC[FKOGPUKQP KGVJGENGCTJQKUVYC[NKPGOC[PGGFVQDGGZVGPFGFVQOGGVVJGTGSWKTGF KPFKECVGFKPVJGTCKNHQTEGCPFDTCEMGVFGVCKNVCDNG#P[TCKNDTCEMGVOQWPVKPIUWTHCEGUVJCVCTGPQVKPNKPGYKVJ UQOGHQTOQHUVGGNUWRRQTVVQRTQRGTN[CVVCEJQWTIWKFGTCKNDTCEMGVU6JGOCZKOWOCNNQYGFDTCEMGVURCEKPIKU+HVJGHNQQTÄVQÄHNQQTJGKIJVGZEGGFUVJGOCZKOWODTCEMGVURCEKPICNNQYGFD[VJGGNGXCVQTEQFG1VKUTGSWKTGU UWRRQTVU GI5VGGNQTEQPETGVGUJCNNPQVGPETQCEJKPVQVJGENGCTJQKUVYC[NKPG VJCPKPFKECVGFD[VJGTCKNHQTEGCPFDTCEMGVURCEKPIFGVCKNVCDNG5GRCTCVQTDGCOUYJGTGTGSWKTGF4CKNÄDTCEMGVJQKUVYC[(QTUVGGNQTYQQFHTCOGEQPUVTWEVKQPCFGSWCVGUWRRQTVHQTVJGVQRTCKNDTCEMGVVQDGKPUVCNNGFPQVNGUU 2TQXKFGCFGSWCVGTCKNDTCEMGVUWRRQTVUDTCEMGVURCEKPICUTGSWKTGFD[IQXGTPKPIEQFGHTQORKVHNQQTVQVQRQH VJCPVJGENGCTFKOGPUKQPUUJQYPKPVCDNGU HNQQTUCPF=OO?KPETGCUGHQTGCEJCFFKVKQPCNHNQQTWRVQCOCZKOWOQH=OO?CPFPQVNGUU 2TQXKFGCENGCTRNWODJQKUVYC[YKVJXCTKCVKQPUHTQOVJGHKIWTGUUJQYPPQVVQGZEGGF=OO?CVVJGHKTUV *QKUVYC[ 2KV2TGR9QTM TGSWKTGF RCVEJKPIRCKPVKPIQHYCNNUHNQQTUQTRCTVKVKQPUVQIGVJGTYKVJHKPKUJRCKPVKPIQHGPVTCPEGFQQTUCPFHTCOGUKH 2TQXKFGEWVQWVUVQCEEQOOQFCVGGNGXCVQTGSWKROGPV VTQWIJKPIXGPVKPICPFJCNNHKZVWTGUCNQPIYKVJVJG QYPGT UWHHKEKGPVTGHWUGEQPVCKPGTUPQVDGRTQXKFGFFKURQUCNQHRCEMCIKPIOCVGTKCNUJCNNDGEQOGVJGTGURQPUKDKNKV[QHVJG2TQXKFGUWHHKEKGPVQPÄUKVGTGHWUGEQPVCKPGTUHQTVJGRTQRGTFKURQUCNQHGNGXCVQTRCEMCIKPIOCVGTKCN5JQWNF OWUVDGCFGSWCVGHQTVYQRGQRNGCPFDGKPRNCEGRTKQTVQVJGJQKUVKPIQHGNGXCVQTGSWKROGPVCFGSWCVG15*#CRRTQXGFHCNNRTQVGEVKQPCVVJGQRGPKPIQHVJGVQRQHVJGJQKUVYC[QPVJGTQQH(CNNRTQVGEVKQP OCEJKPGCPFDGFRNCVGUVTWEVWTGCPFVJGEQPVTQNNGTKPVQRNCEGRTKQTVQGPENQUKPIVJGJQKUVYC[#NUQRTQXKFG 2TQXKFGVJGWUGQHCETCPGUWKVCDNGHQTJQKUVKPICNQCFQHWRVQNDU=MI?HQTJQKUVKPIVJGKPVGITCVGF XQKFKHGSWKROGPVKUUVQTGFKPCOCPPGTQVJGTVJCPCFT[GPENQUGFDWKNFKPIUVTWEVWTG ZHGGV=OOZOO?RGTWPKV#P[YCTTCPVKGURTQXKFGFD[1VKUHQTGNGXCVQTGSWKROGPVCTGPWNNCPF VJGGNGXCVQTJQKUVYC[CVVJGITQWPFNGXGNNQECVGFYKVJKPHGGV=OO?QHVJGJQKUVYC[CPFKUNCTIGTVJCP 2TQXKFGQPÄUKVGUVQTCIGCTGCHQTGNGXCVQTGSWKROGPVCUHQNNQYUFT[CPFGPENQUGFRTQXKFGUTQNNCDNGCEEGUUVQ )GPGTCN2TGR9QTM #..914-/756$'2'4(14/'&2'46*'#22.+%#$.'0#6+10#.#0&14.1%#.%1&'5 $')+00+0)#0&&74+0)6*'+056#..#6+101(6*''.'8#614'37+2/'0624+%'#0&+056#..#6+105%*'&7.'1(16+5+5$#5'&106*'5',1$Ä5+6'%10&+6+105':+56+0)#66*' $;6*'190'414)'0'4#.%1064#%614146*'+4#)'065+0#%%14&#0%'9+6*)18'40+0)%1&'56*' 6*'(1..19+0)+6'/5/756$'2'4(14/'&142418+&'&#601%1566116+5'.'8#614%1/2#0; 16+5 2TGRCTCVQT[9QTMD[1VJGTU QWVCP[QHVJGHQTGIQKPITGSWKTGOGPVU;QWCITGGVQKPFGOPKH[CPFUCXG1VKUJCTONGUUCICKPUVCP[CPFCNNNKCDKNKV[CPFEQUVUCTKUKPIQWVQH[QWTHCKNWTGVQECTT[ XGPVKNCVKQP%QPHKTOCVKQPHQTVJGDTCPEJEKTEWKVUWRRN[KPIVJGECTNKIJVUECTVQRTGEGRVCENGCWZKNKCT[ECTNKIJVKPIRQYGTUQWTEGCPFECT'OGTIGPE[ UVCPFD[RQYGTU[UVGOUJCNNDGEQPPGEVGFVQXQNVRQYGTEKTEWKVCUPQVGFKPPQVG#QHVJG2QYGT TGSWKTGFHTQOVJGGOGTIGPE[ UVCPFD[RQYGTUQWTEG VTKRFGXKEGKURTQXKFGFCPCFFKVKQPCNPQTOCNN[ENQUGFEQPVCEVYKVJCNNCUUQEKCVGFYKTKPICPFEQPFWKVVQVJGEQPVTQNNGTKUYJKEJRTQJKDKVUVJGVTCPUHGTQHRQYGTDGVYGGPNKXGUQWTEGUWPNGUUVJGUQWTEGUCTGKPRJCUGYKVJGCEJQVJGT+HCUJWPV CPFQTGOGTIGPE[ UVCPFD[RQYGTD[CPCFLWUVCDNGRGTKQFQHÄUGEQPFU5YKVEJUJCNNJCXGCRJCUGOQPKVQTHGCVWTGVTCPUHGTCPFVQENQUGYJGPVTCPUHGTKUEQORNGVG5YKVEJVQJCXGCPKPJKDKVHWPEVKQPYJKEJYKNNFGNC[VTCPUHGTVQPQTOCNQPGVQDGQRGPYJGPVJGUYKVEJKUKPVJGGOGTIGPE[ UVCPFD[RQYGTRQUKVKQPVJGQVJGTVQQRGPWRQPKPKVKCVKQPQHRQYGT EQPFKVKQPUCPFVQRGTHQTOVJGVTCPUHGTHTQOQPGVQVJGQVJGT5YKVEJVQJCXGVYQUGVUQHPQTOCNN[ENQUGFFT[EQPVCEVU#PCWVQOCVKERQYGTVTCPUHGTUYKVEJHQTGCEJRQYGTHGGFGTVQOQPKVQTDQVJPQTOCNCPFGOGTIGPE[ UVCPFD[RQYGT TQQOURCEGUWHHKEKGPVRQYGTVQQRGTCVGQPGQTOQTGGNGXCVQTUCVCVKOGCVHWNNTCVGFURGGFCPFTCVGFNQCF HQTUVCTVKPIKV6JGGOGTIGPE[ UVCPFD[RQYGTWPKVUJCNNFGNKXGTVQVJGGNGXCVQTXKCFKUEQPPGEVUYKVEJGUKPVJGEQPVTQN (QTKPUVCNNCVKQPUJCXKPIGOGTIGPE[ UVCPFD[RQYGTRTQXKFGVJGGOGTIGPE[ UVCPFD[RQYGTWPKVCPFOGCPU=1RVKQPCN? TGOQVGGNGXCVQTEQPVTQNKPFKECVQTRCPGNU (QTKPUVCNNCVKQPUJCXKPICNQDD[RCPGNRTQXKFGEQPFWKVVQRCPGNUNQECVGFCYC[HTQOVJGGNGXCVQTJQKUVYC[HQT=1RVKQPCN? NQECVGFKPVGTÄEQOOWPKECVKPIUVCVKQPU%KTEWKVVQDGCTTCPIGFHQTHGGFKPIHTQOVJGDWKNFKPIGOGTIGPE[NKIJVKPIUWRRN[KHRTQXKFGF%QPFWKVCPFYKTKPIHQTTGOQVGN[HWUGF5256FKUEQPPGEVUYKVEJQTEKTEWKVDTGCMGTNQECVGFCUTGSWKTGFHQTVJGKPVGTÄEQOOWPKECVKPIU[UVGORQYGTUWRRN[(QTGNGXCVQTUJCXKPICPKPVGTEQORTQXKFGCUGRCTCVGXQNVCORGTGUKPINGÄRJCUGRQYGTUWRRN[YKVJ=1RVKQPCN? VJGEQPVTQNNGTFGUKIPCVGFD[VJG1VKUEQPUVTWEVKQPUWRGTKPVGPFGPV2TQXKFGQPG FGFKECVGFQWVUKFGVGNGRJQPGNKPGRGTITQWRVQVJGGNGXCVQTEQPVTQNTQQOURCEGCPFVGTOKPCVGFCV VGUVKPICPFCFLWUVKPIVJGGNGXCVQT2TQXKFGGNGEVTKERQYGTHQTNKIJVUVQQNUYGNFKPIJQKUVKPIGVEFWTKPIKPUVCNNCVKQPYKVJUWHHKEKGPVRQYGTHQTUVCTVKPI KPUVCNNGFRKVUWORRWORUJCNNPQVTGSWKTG)(%+RTQVGEVKQPUJCNNDGQHITQWPFÄHCWNVEKTEWKVÄKPVGTTWRVGTV[RG )(%+#FGFKECVGFUKPINGÄRJCUGTGEGRVCENGUWRRN[KPICRGTOCPGPVN[#NNXQNVQTCORGTGUKPINGÄRJCUGTGEGRVCENGUKPUVCNNGFKPRKV UOCEJKPGURCEG UEQPVTQNTQQO UURCEG U NQECVGFRGTVJG1VKUNC[QWVDTGCMGTHQTTGOQVGOQPKVQTKPI6JKUFKUEQPPGEVQTDTGCMGTUJCNNDGECRCDNGQHDGKPINQEMGFKPVJGQRGPRQUKVKQPCPF2TQXKFGCFGFKECVGFXQNVCORGTGUKPINGÄRJCUGRQYGTUWRRN[YKVJCHWUGF5256FKUEQPPGEVUYKVEJQTEKTEWKV KPEQORNKCPEGYKVJVJG0CVKQPCN'NGEVTKECN%QFG=0'%Ä?QT%CPCFKCP'NGEVTKECN%QFG=%'%4WNGÄ? 6JKUDTCPEJEKTEWKVUWRRNKGUVJGECTNKIJVUECTVQRTGEGRVCENGCWZKNKCT[NKIJVKPIRQYGTUQWTEGCPFXGPVKNCVKQPQPGCEJECTDTGCMGT6JKUFKUEQPPGEVQTDTGCMGTUJCNNDGECRCDNGQHDGKPINQEMGFKPVJGQRGPRQUKVKQPCPFNQECVGFRGTVJG1VKUNC[QWV2TQXKFGCFGFKECVGFXQNVCORGTGUKPINGÄRJCUGDTCPEJEKTEWKVYKVJCHWUGFFKUEQPPGEVUYKVEJQTEKTEWKV RTQXKFGF#WVJQTK\CVKQPHTQOVJG1VKUEQPUVTWEVKQPUWRGTKPVGPFGPVKUTGSWKTGFVQKPUVCNNWUKPIVGORQTCT[RQYGTUWRRN[YKVJHWUGFFKUEQPPGEVQTEKTEWKVDTGCMGTHQTGCEJGNGXCVQTCPFCXCKNCDNGKPVJGEQPVTQNTQQO UURCEG UECPDG+HVJTGG RJCUGRQYGTKUPQVCXCKNCDNGCVVJGUVCTVQHKPUVCNNCVKQPCVGORQTCT[UKPINGRJCUG8CORGTGRQYGT YKVJCNNCUUQEKCVGFYKTKPICPFEQPFWKVVQVJGEQPVTQNNGT5K\GQHOCKPEQPVCEVUVQUWKVGNGXCVQTRQYGTEJCTCEVGTKUVKEU=0'%Ä?QT=%'%4WNGÄ?6JGFKUEQPPGEVKPIOGCPUTGSWKTGFD[VJG0CVKQPCN'NGEVTKECN%QFGUJCNNDGRTQXKFGF0CVKQPCN'NGEVTKECN%QFG #05+0(2#QT%CPCFKCP'NGEVTKECN%QFG %YKVJHGGFGTQTDTCPEJYKTKPIVQEQPVTQNNGT HQTO#HWUGFFKUEQPPGEVUYKVEJQTEKTEWKVDTGCMGTECRCDNGQHDGKPINQEMGFKPVJGQRGPRQUKVKQPHQTGCEJGNGXCVQTRGTVJGITQWPFKPIEQPFWEVQTUK\GFCEEQTFKPIVQGNGXCVQTEWTTGPVEJCTCEVGTKUVKEUCUUJQYPQPVJG1VKU%QPHKTOCVKQPQH2QYGT5WRRN[GSWKROGPVITQWPFKPIEQPFWEVQTVGTOKPCVKPIKPVJGEQPVTQNTQQOURCEGNQECVGFRGT1VKUNC[QWV(GGFGTEQPFWEVQTUCPF 2TKQTVQVJGUVCTVQHKPUVCNNCVKQPRTQXKFGCRGTOCPGPVVJTGG RJCUGGNGEVTKECNÄHGGFGTU[UVGOYKVJCUGRCTCVG 'NGEVTKECN4GSWKTGOGPVU 2TQXKFGCHKTGGZVKPIWKUJGTKPCNNEQPVTQNTQQO UURCEG U 2TQXKFGEQPVTQNTQQO UURCEG UCPFFQQTVQEQFGEQORNKCPVHKTGÄTGUKUVKXGEQPUVTWEVKQP #7PKVGF6GEJPQNQIKGU%QORCP[ 4 /#%*+0'411/.'55 /4. 24'2#4#614;914-)GP &9)01 $7+.&+0) 4'8+5+10&#6' #4%*6 190'4 .1%#6+10 %1069+6* %1064#%601 5*''61( )'0Ä6;2Ä/4.Ä29$1 $;16*'45 AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 17 of 23 Attachment number 1Page 41 of 57 16+54'24'5'06#6+8'61%10(+4/;17452'%+(+%.1%#6+10=? 9+&6*:Ä=? &'26*:2+6&'26* Ä=?+(%761764'37+4'&(142+6.#&&'4 =?+05'465+('+6*'41(6*'5'8#4;%1057.66*'6*'5'&+/'05+105#4'$#5'&10*1+569#;5+<'55*190 016'# 5#.'54'24'5'06#6+8' 016'$ $%.120)#%.120)$ %9+%#4+05+&'%9+%#4+05+&' *9%.'#4*569; 2+6 *9%.'#4*569; 2+6 =?5''016'5*''6 *9616#.%.'#4*1+569#; 2+6 '.'8#6145 Ä ( - . %& + % # 4 + 0 5 + & ' *& % . * 5 6 9 ; 2 + 6 Ä +0&+%#6'50146*&+4'%6+10#.#4419 ÄÄÄ &%.120)%%.1120)& *9616#.%.'#4*1+569#; 2+6 '.'8#6145 *9616#.%.'#4*1+569#; 2+6 '.'8#6145 (4106 (4106 (4106 (4106 4 44 2(2( 2( 2(2( 2( 5722.'/'06#4;016'5#22418'& 5*''6 #0&6*#610&'/#0&+6#0%12+'59+..$'241/26.;4'6740'&61 &+5%.15'&+09*1.'14+02#469+6*1766*'94+66'0%105'061(16+5 0'+6*'4+60146*'+0(14/#6+10+6%106#+059+..$'4'241&7%'&14 %10&+6+106*#6+69+..$'75'&10.;(141410$'*#.(1(16+56*#6 '.'8#614%1/2#0; 16+5+6+5&'.+8'4'&6116*'45106*'':24'55 6*+5914-#0&6*'+0(14/#6+10+6%106#+05#4'6*'2412'46;1(16+5 4 % #7PKVGF6GEJPQNQIKGU%QORCP[ )GP &9)01 $7+.&+0) 4'8+5+10&#6' #4%*6 190'4 .1%#6+10 %1069+6* %1064#%601 #..4+)*654'5'48'& 16+5'.'8#614%1/2#0;7027$.+5*'&914- 16+5 &#6'5+)0'& #22418#. 6*+5#44#0)'/'06#0& 4'8+5+105 )'0Ä6;2Ä2Ä20 =?=? = ? =? = ? 5'+5/+%<10'145'+5/+%<10'14 %969+6*5#('6; 2#55'0)'4%#4 *152+6#.%#4 '&Ä':6'0&'&&76;.+/+6'&&76; /4.Ä/#%*+0'//4Ä/#%*+0'411/.'55 411/ 4'#412'0+0)).#55$#%- *#..$76610 5''016'5# +05'465''016'$ %969+6*176 6*+55*''6%18'456*'(1..19+0)%10&+6+105 016' 8#.7'55*190+0=?#4'+0// 5#('6; 2500 3000 3500 4000 24429# 29221# 29221# 29221# 108661N 129976N 129976N 129976N 40660# 48662# 49814# 50225# 180854N 216448N 221572N 223403N 32136# 38392# 38396# 37720# 142941N 170768N 170785N 167779N CAPACITYREF. CWT PF1 PF4 PIT FLOOR FORCES 0 0 PF2 PF3 CAR .... .%%#4 4+)*6*#0& .'(6*#0&'064#0%'#44#0)'/'06 #8#+.#$.'9+6*%#2#%+6+'5 %'06'412'0+0)'064#0%'#44#0)'/'06 #8#+.#$.'9+6*%#2#%+6+'5 .... .%%#4 . ... .%%#4 . ... .%%#4 2+6(.114(14%'5 (14%'55*190#4'&17$.'&(14+/2#%6 4#+.(14%'5#0&$7(('4(14%'5&10161%%745+/7.6#0'175.;4'37+4'/'065(144#+.$4#%-'65722146 016$;16+5 &'(.'%6+1001661':%''&=OO?$#5'&10 *14+<106#.4#+.(14%'5 %#445#('6;#22.+%#6+10 %9644700+0)4.1#&+0)144700+0) ÄÄ=?=?=? Ä CAPACITY HD HW HW2 HW3 HW4 * CWI * CDI CL. OPNG. A B C D F K L 6'-7 1/2"4'-3 1/8"2'-8 1/8" 3'-5" 6 3/8" [2019][1299][816] [1042] [161] 7'-1 1/2" 8' 4" 17'-0" 25'-8" 34'-4" 6'-8 5/16" 4'-9" 3'-6" 5'-2" 2'-5" 2'-1" 3'-11 1/2" 3'-2" 3'-5 3/16" 6 5/16" [2172] [2540] [5182] [7823] [10465] [2040] [1448] [1067] [1575] [737] [635] [1206] [965] [1046] [161] 7'-10"5'-5"3'-6 13/16" 3'-8 1/4" 6 15/16" [2388]9' 4" 19'-0" 28'-8" 38'-4" 7'-8 5/16"[1651]4'-0" 5'-8" 2'-8"[1087] [1124] [177] [2845] [5791] [8738] [11684] [2345] [1219] [1727] [813] * CAB WITH STANDARD 9/16" [15] WALL PANELS 2500 3000 3500 NA NA4000 2500 3000 3500 4000 523# 582# 584# 675# 2325N 2585N 2598N 3002N 53# 77# 105# 119# 234N 342N 463N 529N MAXIMUM BRACKET SPACING RAIL SIZE 287# 305# 297# 294# 1276N 1356N 1321N 1308N 102# 122# 122# 121# 453N 542N 542N 537N MAXIMUM BRACKET SPACING RAIL SIZE RAIL FORCE & BRACKET SPACING DETAIL 14'-0" [4267] #1 #2 CAR CWT R1 R2 R1 R2 16'-0" [4877] REF CAPACITY AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 18 of 23 Attachment number 1Page 42 of 57 Ä = ? $ 1 6 6 1 / 4 # + . 5 7 2 2 1 4 6 $. 6 1 2 . 0 & ) 6 1 7 2 2 ' 4 / 1 5 6 4 # + . 5 7 2 2 1 4 6 Ä = ? * 1 + 5 6 9 # ; . + ) * 6 ## & + 5 6 # 0 % ' ( 4 1 / 6 1 2 . 0 & ) 6 1 / / 5 5 7 2 2 1 4 6 2 + 6 & ' 2 6 * 4+ 5 ' 61 6 1 6 # . 1 8 ' 4 * ' # & %# $ * ' + ) * 6 /#4-+0)(.114 #&'37#6'5722146#6#..(#56'0+0)21+0651('064#0%'#55'/$.;4'37+4'&/7569+6*56#0&#*14+<106#.27..Ä176(14%'1(.$5=MI?"'#(#56'0+0)21+06 "'#'064#0%'+0%.7&+0)5722146(14%'06'45+..5722146$4#%-'6 016$;16+5 )41765612 (+0+5*(.114 5+...+0' 5''016'5*''6 (41069#...+0' &'6#+.#5+..5722146 =?&11452#%' %.120) 417)*12'0+0) 6;2=? '064#0%'&'6#+. (14/#:52#%+0)$'69''0+05'4655''4#+.(14%'&'6#+.5*''6 5'%6+10#.'.'8#6+10 Ä / + 0 = ? 5' ' 0 1 6 ' 5 /+0+/7/(.114*'+)*65 Ä=?9+6*Ä=?'064#0%' Ä=?9+6*Ä=?'064#0%' Ä = ? % . ' # 4 1 2 ' 0 + 0 ) Ä = ? # 8 # + . # $ . ' 9 + 6 * Ä = ? % # $ &'6#+.# *1+569#;.+)*65''016'5*''6 .+)*659+6%* 5''016'% $1661/(.114 612(.114 /#4-+0)(.114(.11461 *'+)*6 5722.'/'06#4;016'5#22418'& 5*''6 #0&6*#610&'/#0&+6#0%12+'59+..$'241/26.;4'6740'&61 &+5%.15'&+09*1.'14+02#469+6*1766*'94+66'0%105'061(16+5 0'+6*'4+60146*'+0(14/#6+10+6%106#+059+..$'4'241&7%'&14 %10&+6+106*#6+69+..$'75'&10.;(141410$'*#.(1(16+56*#6 '.'8#614%1/2#0; 16+5+6+5&'.+8'4'&6116*'45106*'':24'55 6*+5914-#0&6*'+0(14/#6+10+6%106#+05#4'6*'2412'46;1(16+5 4 % #7PKVGF6GEJPQNQIKGU%QORCP[ )GP &9)01 $7+.&+0) 4'8+5+10&#6' #4%*6 190'4 .1%#6+10 %1069+6* %1064#%601 #..4+)*654'5'48'& 16+5'.'8#614%1/2#0;7027$.+5*'&914- 16+5 &#6'5+)0'& #22418#. 6*+5#44#0)'/'06#0& 4'8+5+105 )'0Ä6;2Ä/4.Ä2Ä'. 5'+5/+%<10'145'+5/+%<10'14 %969+6*5#('6; 2#55'0)'4%#4 *152+6#.%#4 '&Ä':6'0&'&&76;.+/+6'&&76; /4.Ä/#%*+0'//4Ä/#%*+0'411/.'55 411/ 4'#412'0+0)).#55$#%- 6*+55*''6%18'456*'(1..19+0)%10&+6+105 %969+6*176 5''5*''6 016' 8#.7'55*190+0=?#4'+0// 5#('6; 016'%*1+569#;.+)*659+6%* .1%#6'&Ä=?#$18'612 .#0&+0)%114&+0#6'9+6*16+5 (.114 (.11461 *'+)*6(.114 5''&'6#+.5 5*''6 5* ' ' 6 %969+6*5#('6;+5016#8#+.#$.'(146*+5%#452''&+(%#452''&#0&41..'4)7+&'5+<' 41.)&5<OO6*'0/+0+/7/2+6&'26*Ä=? +(%#2#%+6;#0&%1706'49'+)*69+6*5#('6;6*'0$./756$'4'&7%'&$;=//? )4176+0)+(4'3&$;16*'455+..#55'/$.; $;16+5 CAB TO MAXIMUM HEIGHT MINIMUM MAXIMUM MINIMUM MINIMUM MAXIMUM RISE 8'-0" 13'-2" 15'-2" 14'-9 3/16"11'-2" [2438] [4013] [4622] [4500] 4'-11 1/4" 15'-3" 197'-0" [3402] 9'-7" 14'-9" 16'-9" 16'-4 3/16" [1505] [4648] [60046] 12'-9" [2921] [4496] [5105] [4983][3886] 8'-0" 13'-10 3/8" 15'-10 3/8" 15'-5 9/16"11'-10 3/8" [2438] [4225] [4835] [4713] 5'-5 1/4" 15'-9 1/2" [3615] 9'-7" 15'-5 3/8" 17'-5 3/8" 17'-0 9/16" [1657] [4813] 13'-5 3/8" [2921] [4709] [5318] [5196] 302'-0" [4099] 8'-0" 14'-4 13/16" 16'-4 13/16" 16'-0" [92050] 12'-1 13/16" [2438] [4389] [4999] [4876] 5'-8" 17'-10 1/2" [3704] 9'-7" 15'-11 13/16" 17'-11 13/16" 17'-7" [1728] [5448] 13'-8 13/16" [2921] [4872] [5481] [5359][4187] 200 FPM BL 350 FPM * 400 FPM AA PIT DEPTHCAR SPEED AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 19 of 23 Attachment number 1Page 43 of 57 *9%.'#4*569; 2+6 *& % . ' # 4 * 5 6 9 ; 2 + 6 $ & # % 1(6*'2'4/+66'& 52#0 .1#&5 #..19564'55'5(1456#6+% #..19 &;0#/+%%10&+6+10564'55 &'5+)0%4+6'4+#(14$7+.&+0)+//'&+#6'57221465 56#6+%%10&+6+10 21%-'6 =? Ä=? = ? 2 1 % - ' 6 .1#&21+06 ÄÄ *9 = ? / + 0 = ? / + 0 =?/+0 =?/+0 .%4'#%6+10.1#& .... %& #$ *9%.'#4*569; 2+6 *9 ÄÄ . ... (4106 = ? / + 0 6 ; 2 = ? / + 0 6 ; 2 /#%*+0'$'#/5 $;16+5 =?=? =?=? 5722.'/'06#4;016'5#22418'& 5*''6 #0&6*#610&'/#0&+6#0%12+'59+..$'241/26.;4'6740'&61 &+5%.15'&+09*1.'14+02#469+6*1766*'94+66'0%105'061(16+5 0'+6*'4+60146*'+0(14/#6+10+6%106#+059+..$'4'241&7%'&14 %10&+6+106*#6+69+..$'75'&10.;(141410$'*#.(1(16+56*#6 '.'8#614%1/2#0; 16+5+6+5&'.+8'4'&6116*'45106*'':24'55 6*+5914-#0&6*'+0(14/#6+10+6%106#+05#4'6*'2412'46;1(16+5 4 % #7PKVGF6GEJPQNQIKGU%QORCP[ )GP &9)01 $7+.&+0) 4'8+5+10&#6' #4%*6 190'4 .1%#6+10 %1069+6* %1064#%601 #..4+)*654'5'48'& 16+5'.'8#614%1/2#0;7027$.+5*'&914- 16+5 &#6'5+)0'& #22418#. 6*+5#44#0)'/'06#0& 4'8+5+105 )'0Ä6;2Ä/4.Ä2Ä/4 5'+5/+%<10'145'+5/+%<10'14 %969+6*5#('6; 2#55'0)'4%#4 *152+6#.%#4 '&Ä':6'0&'&&76;.+/+6'&&76; /4.Ä/#%*+0'//4Ä/#%*+0'411/.'55 411/ 4'#412'0+0)).#55$#%- %969+6*176 .%%#4 .%%#4 6*+55*''6%18'456*'(1..19+0)%10&+6+105 5''5*''6 5' ' 5 * ' ' 6 5''5*''6 016' 8#.7'55*190+0=?#4'+0// 5#('6; (4106 = ? / + 0 *& % . ' # 4 * 5 6 9 ; 2 + 6 5' ' 5 * ' ' 6 /#%*+0'5647%674' =?/+0 =?/+021%-'6 Ä = ? %.4'#%6+10.1#& 016$;16+5 /+0'/$'&&'&2.#6' 21 % - ' 6 ( 5' ' 5 * ' ' 6 &6 ( 5 &6 4 5 $7+.&+0)56''. $;16*'45 &6(5&+56#0%'(41/%#44#+.561(4106.1#&Ä21+06&645&+56#0%'(41/%#44#+.5614'#4.1#&21+06 21 % - ' 6 6 ; 2 &'6#+.# /#%*+0'$'#/5 $;16+5 .% %# 4 4 # + . 5 &'6#+.$ $7+.&+0)56''. $;16*'45 &'6#+. 8'46+%#.5'%6+10 %10%4'6'21%-'6 &'6#+. 8'46+%#.5'%6+10 56''.5722146 = ? / + 0 .1#&21+06 = ? / + 0 /#%*+0'$'#/ $;16+5 $7+.&+0)56''.$;16*'45 /#%*+0'$'#/$;16+5 &'6#+.# %10%4'6'21%-'6 &'6#+.$ 56''.5722146 /#%*+0'$'#/$;16+5 $7+.&+0)56''. $;16*'45 /#%*+0'$'#/.'0)6* /+0.'0)6*.1#&21+0661.1#&21+06 =? &'6#+. %10%4'6'21%-'6 &'6#+. 56''.5722146 CAPACITY MIN. MAX. MIN. MAX. 4'-2 5/16" [1278] 4'-2 1/2" WITHOUT [1282] COUNTERWEIGHT SAFETY 4'-6 3/16" SEISMIC [1376] ZONE 2'-11 1/16" 4'-9 3/4" 6'-5 5/8" 0,1,2,3,4 [891] [1467]4'-6 5/16"[1972] [1380] 4'-6 7/16" WITH [1383] COUNTERWEIGHT SAFETY 4'-10 1/8" [1477] 2500 3000 3500 4000 2500 3000 3500 4000 DTRSDTFS 2500 3000 3500 4000 3.7K 4.2K 4.1K 4.1K 16,2KN 18,7KN 18,4KN 18,3KN 4.0K 4.5K 4.5K 4.5K 17,8KN 20,1KN 19,8KN 19,7KN 6.5K 8.2K 8.2K 8.1K 28,9KN 36,6KN 36,5KN 35,9KN 7.1K 8.8K 8.8K 8.7K 31,3KN 39,1KN 39,0KN 38,5KN 6.9K 8.0K 7.9K 7.8K 30,6KN 35,7KN 35,0KN 34,8KN 7.5K 8.6K 8.4K 8.4K 33,2KN 38,1KN 37,4KN 37,3KN 12.1K 15.5K 15.5K 15.2K 53,8KN 69,1KN 68,8KN 67,8KN 13.0K 16.5K 16.4K 16.2K 58,0KN 73,5KN 73,1KN 72,1KN OVERHEAD BUILDING REACTIONS STATIC A B C D REF CAPACITY MACHINE BEAMS W10x39 DYNAMIC A B C D AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 20 of 23 Attachment number 1Page 44 of 57 ':24'55&4#9 5'%6+10<Ä< /+0+/7/%10641.52#%'4'37+4'/'065 10'%#4 Ä=? Ä=? #$ 24'('44'& /+0+/7/ Ä=? Ä=? 5 ' ' 0 1 6 ' ' 10'%#4 411/4'37+4'/'065 /+0+/7/%10641. < < < < /#+0.+0'5 .+)*659 016$;16+5 /#+0.+0'5 .+)*659 5''016'( 016$;16+5 $.1%-176+09#..61#..19 '.'%64+%#.6417)*+0) %10&7+65+<'5*190+5(14 %#4#44#0)'/'069 %10641.52#%'411/#66*' 612.#0&+0) 5''016'+024'2#4#614; 914-$;16*'45 (4106*1+569#;.+0' =?Ä = ? /+ 0 + / 7 / Ä = ? Ä=? Ä=? Ä = ? Ä #$ Ä = ? /+ 0 + / 7 / % . ' # 4 * ' + ) * 6 Ä = ? Ä = ? 8#4+'5 &1 1 4 /+0%.4 & 1 7 $ . ' & 1 1 4 / + 0 4 1 1 / 9 + & 6 * 016'( 6*'(4106574(#%'1(6*'/#+0.+0'&+5%100'%6/756 241,'%6+061%.'#412'0+0)1(%10641.52#%' +(6*'5+<'1(6*'%10641.52#%'+5+0%4'#5'& #/'#051(.1%#6+0)6*'/#+0.+0'&+5%100'%6+0616*' %.'#412'0+0)/756$'2418+&'& 016'' %*'%-.1%#.$7+.&+0)%1&'5(14*#..9#; %.'#4#0%'59*'0%10641.&1145#4'12'0'& (145'48+%'1(6*''.'8#614 =? =? /+0%.4 4'37+4'/'065691%#4 12215+6'9#..5 9+6*%10641..'4510 /+0+/7/%10641.411/ /+0+/7/%10641.411/ 9+6*%10641..'4510 4'37+4'/'065(14691%#4 #&,#%'069#..5 Ä=? << &114 Ä=? Ä=?&114 Ä=? 5'%6+10<Ä< Ä = ? /+ 0 + / 7 / % . ' # 4 * ' + ) * 6 Ä = ? 016$;16+5 .+)*659+6%* /#+0.+0'5 56#%-'& /+0%.4 Ä=? Ä = ? < /+ 0 % . 4 /+0%.4 /+0%.4 /+ 0 % . 4 Ä = ? < Ä=? Ä=? Ä = ? 016$;16+5.+)*659+6%*/#+0.+0' Ä = ? Ä=? 914-$;16*'45 5''016'+024'2#4#614; 612.#0&+0) %10641.52#%'411/#66*' %#4#44#0)'/'069 %10&7+65+<'5*190+5(14 '.'%64+%#.6417)*+0) $.1%-176+09#..61#..19 (4106*1+569#;.+0' Ä = ? 8#4+'5 =? =? 9'+)*6NDU=MI? %10641..'4&+/'05+105 Ä=? Ä = ? Ä = ? Ä Ä=? = ? 5722.'/'06#4;016'5#22418'& 5*''6 #0&6*#610&'/#0&+6#0%12+'59+..$'241/26.;4'6740'&61 &+5%.15'&+09*1.'14+02#469+6*1766*'94+66'0%105'061(16+5 0'+6*'4+60146*'+0(14/#6+10+6%106#+059+..$'4'241&7%'&14 %10&+6+106*#6+69+..$'75'&10.;(141410$'*#.(1(16+56*#6 '.'8#614%1/2#0; 16+5+6+5&'.+8'4'&6116*'45106*'':24'55 6*+5914-#0&6*'+0(14/#6+10+6%106#+05#4'6*'2412'46;1(16+5 4 % #7PKVGF6GEJPQNQIKGU%QORCP[ )GP &9)01 $7+.&+0) 4'8+5+10&#6' #4%*6 190'4 .1%#6+10 %1069+6* %1064#%601 #..4+)*654'5'48'& 16+5'.'8#614%1/2#0;7027$.+5*'&914- 16+5 &#6'5+)0'& #22418#. 6*+5#44#0)'/'06#0& 4'8+5+105 )'0Ä6;2Ä%4 016'8#.7'55*190+0=?#4'+0// AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 21 of 23 Attachment number 1Page 45 of 57 ':24'55&4#9 /+ 0 + / 7 / % . ' # 4 * ' + ) * 6 016$;16+5 .+)*659+6%*56#%-'&/#+0.+0'5 < 6*4''%#4#44#0)'/'064'37+4'/'065(14#/+0+/7/%10641.411/ 5'%6+10<Ä< Ä = ? /+ 0 % . 4 < Ä=? /+0%.4 Ä=? Ä = ? 914-$;16*'45 5''016'+024'2#4#614; 612.#0&+0) %10641.52#%'411/#66*' %#4#44#0)'/'069 %10&7+65+<'5*190+5(14 '.'%64+%#.6417)*+0) $.1%-176+09#..61#..19 (4106*1+569#;.+0' Ä = ? Ä = ? 8#4+'5 =? Ä = ? &1 1 4 Ä = ? =? &1 1 4 016$;16+5 .+)*659+6%*56#%-'&/#+0.+0'5 < Ä = ? < /+ 0 % . 4 /+ 0 % . 4 /+0+/7/%10641.411/ 4'37+4'/'065(14# (174%#4#44#0)'/'06 Ä = ? Ä = ? Ä=? Ä = ? (4106*1+569#;.+0' 5'%6+10<Ä< Ä = ? Ä = ? Ä=? =? /+ 0 + / 7 / % . ' # 4 * ' + ) * 6 Ä = ? 914-$;16*'45 5''016'+024'2#4#614; 612.#0&+0) %10641.52#%'411/#66*' %#4#44#0)'/'069 %10&7+65+<'5*190+5(14 '.'%64+%#.6417)*+0) $.1%-176+09#..61#..19 =? 9'+)*6NDU=MI? %10641..'4&+/'05+105 Ä=? Ä = ? Ä = ? Ä Ä=? = ? 5722.'/'06#4;016'5#22418'& 5*''6 #0&6*#610&'/#0&+6#0%12+'59+..$'241/26.;4'6740'&61 &+5%.15'&+09*1.'14+02#469+6*1766*'94+66'0%105'061(16+5 0'+6*'4+60146*'+0(14/#6+10+6%106#+059+..$'4'241&7%'&14 %10&+6+106*#6+69+..$'75'&10.;(141410$'*#.(1(16+56*#6 '.'8#614%1/2#0; 16+5+6+5&'.+8'4'&6116*'45106*'':24'55 6*+5914-#0&6*'+0(14/#6+10+6%106#+05#4'6*'2412'46;1(16+5 4 % #7PKVGF6GEJPQNQIKGU%QORCP[ )GP &9)01 $7+.&+0) 4'8+5+10&#6' #4%*6 190'4 .1%#6+10 %1069+6* %1064#%601 #..4+)*654'5'48'& 16+5'.'8#614%1/2#0;7027$.+5*'&914- 16+5 &#6'5+)0'& #22418#.6*+5#44#0)'/'06#0& 4'8+5+105 )'0Ä6;2Ä%4 016'8#.7'55*190+0=?#4'+0// AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 22 of 23 Attachment number 1Page 46 of 57 AJC - EXHIBIT B-4 - BID PACKAGE FOUR - SCHEDULE "A" - ATTACHMENT "C" OTIS ELEVATOR PROPOSAL FEBRUARY 20, 2009 23 of 23 Attachment number 1Page 47 of 57 Page 1 of 5 AJC - Tracking Budget Est 2/20/2009 11:16 AM B-4 Schedule "A" Attachment"D" Augusta Richmond County Judicial Center - 36 Tracking Budget Estimate at Bid Package 04 - Critical Path Exhibit B-4 Schedule "A" Attachment "D" Project name AJC - Tracking Budget Est B-4 Schedule "A" Attachment"D" Augusta GA Estimator GRL/JGS/JCB/SWH Bid date 2/20/2009 5:00 PM Report format Sorted by 'Group phase/Phase' 'Phase' summary Allocate addons Print item notes Attachment number 1Page 48 of 57 Page 2 of 5 AJC - Tracking Budget Est 2/20/2009 11:16 AM B-4 Schedule "A" Attachment"D" Description Quantity Labor Unit Cost Amount Material Unit Cost Amount Subcontract Unit Cost Amount Total Unit Cost Amount 02000.0 SITE CONSTRUCTION 02060.0 Site Demolition 182,668.00 sqft 02080.0 Hazardous Material Abate 182,668.00 sqft 02105.0 Site Engineering 182,668.00 sqft 0.092/sqft 16,720 0.092/sqft 16,720 02210.0 Site Grading 182,668.00 sqft 3.86 /sqft 704,621 3.86 /sqft 704,621 02211.0 Finish Site Grading/Bobca 182,668.00 sqft 0.103/sqft 18,875 0.103/sqft 18,875 02215.0 Erosion Control 182,668.00 sqft 02280.0 Soil Treatment 182,668.00 sqft 0.031/sqft 5,580 0.031/sqft 5,580 02370.0 Bored/Augered Piles 182,668.00 sqft 4.68 /sqft 854,842 4.68 /sqft 854,842 02510.0 Asphaltic Concrete Paving 182,668.00 sqft 3.05 /sqft 556,414 3.05 /sqft 556,414 02515.0 Unit Pavers 182,668.00 sqft 0.50 /sqft 90,381 0.50 /sqft 90,381 02521.0 Concrete Curb & Gutter 182,668.00 sqft 0.74 /sqft 135,166 0.74 /sqft 135,166 02522.0 Walks & Pads 182,668.00 sqft 0.22 /sqft 39,909 0.384/sqft 70,075 0.602/sqft 109,984 02580.0 Pavement Marking 182,668.00 sqft 0.06 /sqft 10,719 0.06 /sqft 10,719 02660.0 Water Distribution 182,668.00 sqft 02685.0 Gas Distribution Systems 182,668.00 sqft 02710.0 Subdrainage Systems 182,668.00 sqft 02720.0 Storm Sewerage 182,668.00 sqft 02730.0 Sanitary Sewer 182,668.00 sqft 02785.0 Electrical Power Transmis 182,668.00 sqft 02790.0 Site Commun. Conduits 182,668.00 sqft 0.093/sqft 16,936 0.093/sqft 16,936 02801.0 Modular Retaining Walls 182,668.00 sqft 02830.0 Fences 182,668.00 sqft 0.19 /sqft 34,330 0.19 /sqft 34,330 02870.0 Site & Street Furnishings 182,668.00 sqft 0.304/sqft 55,496 0.14 /sqft 25,000 0.441/sqft 80,496 02900.0 Landscaping 182,668.00 sqft 1.06 /sqft 193,418 1.06 /sqft 193,418 SITE CONSTRUCTION 182,668.00 sqft 0.63 /sqft 114,279 14.86 /sqft 2,714,202 15.484/sqft 2,828,481 03000.0 CONCRETE 03210.0 Reinforcing Steel 182,668.00 sqft 0.59 /sqft 106,929 0.59 /sqft 106,929 03300.0 Cast in Place Concrete 182,668.00 sqft 0.04 /sqft 7,348 0.06 /sqft 10,605 0.10 /sqft 17,953 03305.0 Concrete Pumping 182,668.00 sqft 0.01 /sqft 905 0.01 /sqft 905 03310.A Structural Concrete 182,668.00 sqft 37.19 /sqft 6,793,093 37.19 /sqft 6,793,093 CONCRETE 182,668.00 sqft 0.63 /sqft 114,277 37.251/sqft 6,804,603 37.88 /sqft 6,918,880 04000.0 MASONRY 04200.0 Unit Masonry 182,668.00 sqft 3.20 /sqft 584,335 6.632/sqft 1,211,409 9.831/sqft 1,795,744 04200.2 Unit Masonry - CMU Walls 182,668.00 sqft 1.07 /sqft 195,076 0.944/sqft 172,461 2.012/sqft 367,537 04400.0 Stone 182,668.00 sqft 0.922/sqft 168,492 0.922/sqft 168,492 MASONRY 182,668.00 sqft 4.27 /sqft 779,411 8.50 /sqft 1,552,362 12.77 /sqft 2,331,774 05000.0 METALS 05120.0 Structural Steel 182,668.00 sqft 2.79 /sqft 509,404 2.79 /sqft 509,404 05160.0 Framing System/Pre-Engine 182,668.00 sqft 05720.0 Ornamental Handrails Rail 182,668.00 sqft 0.67 /sqft 122,400 0.67 /sqft 122,400 METALS 182,668.00 sqft 3.46 /sqft 631,804 3.46 /sqft 631,804 06000.0 WOOD AND PLASTICS 06050.0 Fasteners & Adhesives 182,668.00 sqft 0.091/sqft 16,614 0.091/sqft 16,614 06100.0 Rough Carpentry 182,668.00 sqft 0.52 /sqft 94,457 0.193/sqft 35,182 0.71 /sqft 129,639 Attachment number 1Page 49 of 57 Page 3 of 5 AJC - Tracking Budget Est 2/20/2009 11:16 AM B-4 Schedule "A" Attachment"D" Description Quantity Labor Unit Cost Amount Material Unit Cost Amount Subcontract Unit Cost Amount Total Unit Cost Amount 06220.0 Millwork 182,668.00 sqft 16.38 /sqft 2,991,265 16.38 /sqft 2,991,265 06240.0 Laminates 182,668.00 sqft 1.27 /sqft 231,629 1.27 /sqft 231,629 06450.0 Standing & Running Trim 182,668.00 sqft 0.39 /sqft 70,648 0.39 /sqft 70,648 06600.0 GFRC Fabrications 182,668.00 sqft 0.894/sqft 163,255 1.74 /sqft 317,080 2.63 /sqft 480,335 WOOD AND PLASTICS 182,668.00 sqft 0.52 /sqft 94,457 1.18 /sqft 215,051 19.77 /sqft 3,610,622 21.46 /sqft 3,920,130 4,160.00 Labor hours 07000.0 THERMAL AND MOISTURE PROT 07100.0 Waterproofing 182,668.00 sqft 0.073/sqft 13,389 0.073/sqft 13,389 07150.0 Dampproofing 182,668.00 sqft 0.044/sqft 8,077 0.044/sqft 8,077 07240.0 Stucco Soffits 182,668.00 sqft 0.182/sqft 33,162 0.182/sqft 33,162 07250.0 Fireproofing 182,668.00 sqft 0.192/sqft 35,037 0.192/sqft 35,037 07510.0 Modified Bitumen Roofing 182,668.00 sqft 7.02 /sqft 1,282,213 7.02 /sqft 1,282,213 07610.0 Metal Roofing 182,668.00 sqft 2.013/sqft 367,797 2.013/sqft 367,797 07920.0 Sealants & Caulking 182,668.00 sqft 0.52 /sqft 94,853 0.52 /sqft 94,853 THERMAL AND MOISTURE PROT 182,668.00 sqft 10.043/sqft 1,834,527 10.043/sqft 1,834,527 08000.0 DOORS AND WINDOWS 08001.0 Doors, Frames, & Hardware 182,668.00 sqft 4.422/sqft 807,668 0.824/sqft 150,580 5.25 /sqft 958,248 08360.0 Overhead Doors 182,668.00 sqft 0.771/sqft 140,882 0.771/sqft 140,882 08410.0 Aluminum Entrances & Stor 182,668.00 sqft 5.46 /sqft 996,481 5.46 /sqft 996,481 DOORS AND WINDOWS 182,668.00 sqft 4.422/sqft 807,668 7.051/sqft 1,287,943 11.472/sqft 2,095,611 09000.0 FINISHES 09250.0 Gypsum Wallboard 182,668.00 sqft 19.92 /sqft 3,638,033 19.92 /sqft 3,638,033 09300.0 Tile 182,668.00 sqft 0.70 /sqft 127,759 0.70 /sqft 127,759 09380.0 Terrazzo 182,668.00 sqft 2.644/sqft 482,901 2.644/sqft 482,901 09525.0 Resilient Flooring 182,668.00 sqft 0.40 /sqft 72,351 0.40 /sqft 72,351 09680.0 Carpet 182,668.00 sqft 2.772/sqft 506,309 2.772/sqft 506,309 09780.0 Floor Treatment 182,668.00 sqft 0.04 /sqft 7,173 0.071/sqft 13,000 0.11 /sqft 20,173 09800.0 Special Coatings 182,668.00 sqft 1.174/sqft 214,375 1.174/sqft 214,375 09900.0 Painting 182,668.00 sqft 1.494/sqft 272,906 1.494/sqft 272,906 09950.0 Wallcovering 182,668.00 sqft 0.43 /sqft 78,280 0.43 /sqft 78,280 FINISHES 182,668.00 sqft 0.04 /sqft 7,173 29.594/sqft 5,405,914 29.633/sqft 5,413,087 10000.0 SPECIALTIES 10115.0 Marker Boards 182,668.00 sqft 0.02 /sqft 3,427 0.02 /sqft 3,427 10165.0 Toilet Partitions & Acces 182,668.00 sqft 0.67 /sqft 122,385 0.67 /sqft 122,385 10200.0 Louvers & Vents 182,668.00 sqft 10260.0 Wall & Corner Guards 182,668.00 sqft 0.03 /sqft 5,350 0.03 /sqft 5,350 10270.0 Access Flooring 182,668.00 sqft 10350.0 Flagpoles 182,668.00 sqft 0.08 /sqft 13,950 0.08 /sqft 13,950 10440.0 Signage 182,668.00 sqft 0.821/sqft 150,000 0.821/sqft 150,000 10500.0 Lockers 182,668.00 sqft 10520.0 Fire Ext. Cabinets, Acces 182,668.00 sqft 0.03 /sqft 4,711 0.03 /sqft 4,711 10650.0 Operable Partitions 182,668.00 sqft 10850.0 Miscellaneous Specialties 182,668.00 sqft SPECIALTIES 182,668.00 sqft 0.06 /sqft 10,061 1.59 /sqft 289,762 1.641/sqft 299,823 Attachment number 1Page 50 of 57 Page 4 of 5 AJC - Tracking Budget Est 2/20/2009 11:16 AM B-4 Schedule "A" Attachment"D" Description Quantity Labor Unit Cost Amount Material Unit Cost Amount Subcontract Unit Cost Amount Total Unit Cost Amount 11000.0 EQUIPMENT 11020.0 Security & Vault Equipmen 182,668.00 sqft 11130.0 Audio Visual Equipment 182,668.00 sqft 11190.0 Security and Detention Eq 182,668.00 sqft 4.05 /sqft 738,830 4.05 /sqft 738,830 11452.0 Residential Appliance 182,668.00 sqft EQUIPMENT 182,668.00 sqft 4.05 /sqft 738,830 4.05 /sqft 738,830 12000.0 FURNISHINGS 12500.0 Window Treatments 182,668.00 sqft 0.09 /sqft 16,485 0.09 /sqft 16,485 12690.0 Entry Mats 182,668.00 sqft 0.023/sqft 4,271 0.022/sqft 3,992 0.05 /sqft 8,263 12700.0 Multiple Seating 182,668.00 sqft 0.692/sqft 126,447 0.692/sqft 126,447 FURNISHINGS 182,668.00 sqft 0.023/sqft 4,271 0.804/sqft 146,924 0.83 /sqft 151,195 13000.0 SPECIAL CONSTRUCTION 13120.0 Division 13 Subcontractor 182,668.00 sqft 0.15 /sqft 27,374 0.15 /sqft 27,374 SPECIAL CONSTRUCTION 182,668.00 sqft 0.15 /sqft 27,374 0.15 /sqft 27,374 14000.0 CONVEYING SYSTEMS 14200.0 Elevators 182,668.00 sqft 4.34 /sqft 791,900 4.34 /sqft 791,900 14400.0 Lifts 182,668.00 sqft CONVEYING SYSTEMS 182,668.00 sqft 4.34 /sqft 791,900 4.34 /sqft 791,900 15000.0 MECHANICAL 15300.0 Fire Protection 182,668.00 sqft 2.361/sqft 431,300 2.361/sqft 431,300 15400.0 Plumbing 182,668.00 sqft 15500.0 HVAC 182,668.00 sqft 27.38 /sqft 5,001,338 27.38 /sqft 5,001,338 MECHANICAL 182,668.00 sqft 29.741/sqft 5,432,638 29.741/sqft 5,432,638 16000.0 ELECTRICAL 16010.0 Electrical Subcontractor 182,668.00 sqft 28.693/sqft 5,241,329 28.693/sqft 5,241,329 16600.0 Special Systems 182,668.00 sqft ELECTRICAL 182,668.00 sqft 28.693/sqft 5,241,329 28.693/sqft 5,241,329 17000.0 MISCELLANEOUS 17100.0 Miscellaneous 182,668.00 sqft Attachment number 1Page 51 of 57 Page 5 of 5 AJC - Tracking Budget Est 2/20/2009 11:16 AM B-4 Schedule "A" Attachment"D" Estimate Totals Description Amount Totals Hours Rate Cost Basis Cost per Unit Labor 94,457 4,160.000 hrs Material 2,052,192 Subcontract 36,510,736 Equipment Other 38,657,385 38,657,385 Sub Bonds 730,215 2.000 %C 730,215 39,387,600 Dtl Design/Market Ctngy 1,384,320 L 1,384,320 40,771,920 Escalation 1,672,362 4.102 %T 1,672,362 42,444,282 CM/GC Contingency 1,061,107 2.500 %T 1,061,107 43,505,389 Lump Sum GC/Fee/Precon 4,994,611 L 4,994,611 48,500,000 Total 48,500,000 Attachment number 1Page 52 of 57 Page 1 of 4 AJC Exhibit B-4 - Bid Package Four Schedule "A" - Attachment "E" 2/20/2009 11:24 AM Item Description Total Amount AJC-36 AJC-30 Variance 02000.0 SITE CONSTRUCTION 02060.0 Site Demolition 02080.0 Hazardous Material Abate 02105.0 Site Engineering 16,720 16,720 0 02210.0 Site Grading 704,621 704,621 0 02211.0 Finish Site Grading/Bobca 17,640 17,640 0 02215.0 Erosion Control 02280.0 Soil Treatment 5,580 5,580 0 02370.0 Bored/Augered Piles 854,842 854,842 0 02510.0 Asphaltic Concrete Paving 556,414 556,414 0 02515.0 Unit Pavers 90,381 90,381 0 02521.0 Concrete Curb & Gutter 135,166 135,166 0 02522.0 Walks & Pads 107,373 107,373 0 02580.0 Pavement Marking 10,719 10,719 0 02660.0 Water Distribution 02685.0 Gas Distribution Systems 02710.0 Subdrainage Systems 02720.0 Storm Sewerage 02730.0 Sanitary Sewer 02785.0 Electrical Power Transmis 02790.0 Site Commun. Conduits 16,936 16,936 0 02801.0 Modular Retaining Walls 02830.0 Fences 34,330 34,330 0 02870.0 Site & Street Furnishings 76,865 76,865 0 02900.0 Landscaping 193,418 193,418 0 SITE CONSTRUCTION 2,821,005 2,821,005 0 03000.0 CONCRETE 03210.0 Reinforcing Steel 99,934 99,934 0 03300.0 Cast in Place Concrete 17,472 17,472 0 03305.0 Concrete Pumping 905 905 0 03310.A Structural Concrete 6,793,093 6,793,093 0 CONCRETE 6,911,404 6,911,404 0 04000.0 MASONRY 04200.0 Unit Masonry 1,757,517 1,757,517 0 04200.2 Unit Masonry - CMU Walls 354,775 354,775 0 04400.0 Stone 168,492 168,492 0 MASONRY 2,280,784 2,280,784 0 05000.0 METALS 05120.0 Structural Steel 509,404 168,000 341,404 05160.0 Framing System/Pre-Engine 05720.0 Ornamental Handrails Rail 122,400 122,400 0 METALS 631,804 290,400 341,404 06000.0 WOOD AND PLASTICS 06050.0 Fasteners & Adhesives 15,527 15,527 0 06100.0 Rough Carpentry 127,337 127,337 0 06220.0 Millwork 2,991,265 2,991,265 0 06240.0 Laminates 231,629 231,629 0 06450.0 Standing & Running Trim 70,648 70,648 0 06600.0 GFRC Fabrications 469,655 469,655 0 Attachment number 1Page 53 of 57 Page 2 of 4 AJC Exhibit B-4 - Bid Package Four Schedule "A" - Attachment "E" 2/20/2009 11:24 AM Item Description Total Amount AJC-36 AJC-30 Variance WOOD AND PLASTICS 3,906,061 3,906,061 0 07000.0 THERMAL AND MOISTURE PROT 07100.0 Waterproofing 13,389 13,389 0 07150.0 Dampproofing 8,077 8,077 0 07240.0 Stucco Soffits 33,162 33,162 0 07250.0 Fireproofing 35,037 35,037 0 07510.0 Modified Bitumen Roofing 1,282,213 1,282,213 0 07610.0 Metal Roofing 367,797 367,797 0 07920.0 Sealants & Caulking 94,853 94,853 0 THERMAL AND MOISTURE PROT 1,834,527 1,834,527 0 08000.0 DOORS AND WINDOWS 08001.0 Doors, Frames, & Hardware 905,410 905,410 0 08360.0 Overhead Doors 140,882 140,882 0 08410.0 Aluminum Entrances & Stor 996,481 996,481 0 DOORS AND WINDOWS 2,042,773 2,042,773 0 09000.0 FINISHES 09250.0 Gypsum Wallboard 3,638,033 3,083,909 554,124 09300.0 Tile 127,759 127,759 0 09380.0 Terrazzo 482,901 482,901 0 09525.0 Resilient Flooring 72,351 72,351 0 09680.0 Carpet 506,309 506,309 0 09780.0 Floor Treatment 19,704 19,704 0 09800.0 Special Coatings 214,375 214,375 0 09900.0 Painting 272,906 272,906 0 09950.0 Wallcovering 78,280 78,280 0 FINISHES 5,412,618 4,858,494 554,124 10000.0 SPECIALTIES 10115.0 Marker Boards 3,427 3,427 0 10165.0 Toilet Partitions & Acces 122,385 122,385 0 10200.0 Louvers & Vents 10260.0 Wall & Corner Guards 5,000 5,000 0 10270.0 Access Flooring 10350.0 Flagpoles 13,950 13,950 0 10440.0 Signage 150,000 150,000 0 10500.0 Lockers 10520.0 Fire Ext. Cabinets, Acces 4,403 4,403 0 10650.0 Operable Partitions 10850.0 Miscellaneous Specialties SPECIALTIES 299,165 299,165 0 11000.0 EQUIPMENT 11020.0 Security & Vault Equipmen 11130.0 Audio Visual Equipment 18,000 (18,000) 11190.0 Security and Detention Eq 738,830 1,250,830 (512,000) 11452.0 Residential Appliance 11900.0 Acoustical Wall Treatment 85,998 (85,998) Attachment number 1Page 54 of 57 Page 3 of 4 AJC Exhibit B-4 - Bid Package Four Schedule "A" - Attachment "E" 2/20/2009 11:24 AM Item Description Total Amount AJC-36 AJC-30 Variance EQUIPMENT 738,830 1,354,828 (615,998) 12000.0 FURNISHINGS 12500.0 Window Treatments 16,485 16,485 0 12690.0 Entry Mats 7,984 7,984 0 12700.0 Multiple Seating 126,447 126,447 0 FURNISHINGS 150,916 150,916 0 13000.0 SPECIAL CONSTRUCTION 13120.0 Division 13 Subcontractor 27,374 100,770 (73,396) SPECIAL CONSTRUCTION 27,374 100,770 (73,396) 14000.0 CONVEYING SYSTEMS 14200.0 Elevators 791,900 782,000 9,900 14400.0 Lifts CONVEYING SYSTEMS 791,900 782,000 9,900 15000.0 MECHANICAL 15300.0 Fire Protection 431,300 582,470 (151,170) 15400.0 Plumbing 1,638,219 (1,638,219) 15500.0 HVAC 5,001,338 4,569,631 431,707 MECHANICAL 5,432,638 6,790,321 (1,357,683) 16000.0 ELECTRICAL 16010.0 Electrical Subcontractor 5,241,329 3,364,175 1,877,154 16600.0 Special Systems 203,547 (203,547) 16610.0 Fire Alarm System 246,602 (246,602) 16700.0 k 359,074 (359,074) ELECTRICAL 5,241,329 4,173,398 1,067,931 17000.0 MISCELLANEOUS 17100.0 Miscellaneous Total 38,523,129 38,596,846 (73,718) Attachment number 1Page 55 of 57 Page 4 of 4 AJC Exhibit B-4 - Bid Package Four Schedule "A" - Attachment "E" 2/20/2009 11:24 AM Item Description Total Amount AJC-36 AJC-30 Variance Estimate Totals Labor 94,457 94,457 0 Material 1,917,936 1,917,936 0 Subcontract 36,510,736 36,584,453 (73,717) Equipment 0 0 0 Other 0 0 0 38,523,129 38,596,846 (73,717) Sales Tax 134,256 134,256 0 38,657,385 38,731,102 (73,717) Sub Bonds 730,215 731,689 (1,474) 39,387,600 39,462,791 (75,191) Dtl Design/Market Ctngy 1,384,320 1,309,129 75,191 40,771,920 40,771,920 0 Escalation 1,672,362 1,672,362 0 42,444,282 42,444,282 0 CM/GC Contingency 1,061,107 1,061,107 0 43,505,389 43,505,389 0 Lump Sum GC/Fee/Precon 4,994,611 4,994,611 0 48,500,000 48,500,000 0 Total 48,500,000 48,500,000 0 Attachment number 1Page 56 of 57 Unit AdditionalDOTTypeCSiltFence lnft 48"OrangeTreeSaveFence lnft Sd2 Commission Meeting Agenda 3/17/2009 12:00 PM Approve payment to Eagle Utility for emergency repair work on Doug Barnard Parkway. Department: Caption:Motion to approve $29,626.25 to Eagle Utility for emergency repair work on Doug Barnard Parkway. (Approved by Engineering Services Committee March 9, 2009) Background:On December 31, 2008 Augusta Utilities was alerted to a possible sanitary sewer cave in on Doug Barnard Parkway near Dan Bowles Road. In the interest of public safety, Augusta utilities deployed several personnel to the site to temporarily reroute traffic around the depression in the pavement. Eagle Utility was contacted and able to respond with a crew and equipment quickly to investigate and repair the cause of the pavement collapse. Eagle crews worked New Year’s Eve, New Year’s Day and two more days to repair the problem and return the road to a state of use. Analysis:Augusta Utilities Supervisors contacted Eagle Utility to make the repairs on Doug Barnard because they could respond quickly and stay on task until completion. Due to the nature of a road collapse and the possible negative effect on the travelling public, time is of the essence in these situations. Augusta Utilities staff evaluated several options and concluded Eagle Utility to be the most fair and reasonable. Financial Impact:Funds are available from the following: 507043420-5425210/80900005- 5425210 Alternatives:None Recommendation:Approve payment to Eagle Utility in the amount of $29,626.25 for emergency repair work. Funds are Available in the Following Accounts: 507043420-5425210/80900005-5425210 REVIEWED AND APPROVED BY: Finance. Procurement. Law. Cover Memo Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 1 Commission Meeting Agenda 3/17/2009 12:00 PM Augusta Levee Certification/FERC Dam Safety Performance Monitoring Program Department:Abie L. Ladson, PE, CPESC, Director of Engineering Caption:Motion to approve Capital Project Budget (CPB) and Supplemental Agreement Number One for the FERC Dam Safety Performance Monitoring Program in the amount of $624,470.00 to certify the Augusta Levee in accordance with both FEMA (Federal Emergency Management Agency), and the Army Corp of Engineers guidelines. (Approved by Engineering Services Committee March 9, 2009) Background:The Augusta City Levee is approximately 16,000 feet long (11.55 miles long), and extends from Lake Olmstead to Butler Creek. The original levee was constructed between 1908 and 1916, and in 1937 the U.S. Army Corps of Engineers raised the levee after the floods of 1929. In 1941, the Army Corp of Engineers passed the ownership of the levee to the City of Augusta. In 2007, Congress passed the National Levee Safety Act to establish an inventory and inspection program for the nation’s levees because of the levee failures during Hurricane Katrina and other catastrophic levee failures along the Mississippi in the last decade. The City of Augusta has entered into an agreement with FEMA as a requirement for the new digital maps. The City would be designated as a Provisionally Accredited Levee (PAL) until the levee is certified. FEMA is requiring the Augusta Levee to be certified by a qualified Professional Engineer to insure the area behind the levee is protected in the event of a 100-year storm. If the levee is not certified under the PAL Agreement by December 28, 2009, the residents behind the levee would require flood insurance. A non-certification of the levee would affect approximately 4,000 parcels (52,000 acres). Analysis:Augusta-Richmond County Utilities Department is currently under contract with the Cranston Engineering Group, Inc. to have the Augusta Canal licensed through the Federal Energy Regulatory Commission (FERC). The Augusta Levee Certification would be a direct overlap of the licensing for the canal on the western portion of the levee. The levee certification process will consist of detail surveying and engineering services (A detailed scope services is attached). The estimated time to complete the certification process is six months. Financial Impact:Funds of $340,975.00 are available in the Lake Aumond Dam Improvement Project to be transferred to the Augusta Levee project as well as an additional $283,495.00 to be transferred from Phase IV Recapture to fully fund the project. Alternatives:1) Approve Capital Project Budget (CPB) and Supplemental Agreement Number One for the FERC Dam Safety Performance Monitoring Program in Cover Memo the amount of $624,470.00 to certify the Augusta Levee in accordance with both FEMA (Federal Emergency Management Agency), and the Army Corp of Engineers guidelines. 2) Do not approve, and require the residents behind the levee to purchase flood insurance. Recommendation:Approve Alternative Number One. Funds are Available in the Following Accounts: 324-041110-6011110/207824999-6011110 - $283,495 324-04- 1110/2038240088 - $340,975 REVIEWED AND APPROVED BY: Finance. Procurement. Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 20 Attachment number 1Page 2 of 20 Attachment number 1Page 3 of 20 Attachment number 1Page 4 of 20 Attachment number 1Page 5 of 20 Attachment number 1Page 6 of 20 Attachment number 1Page 7 of 20 Attachment number 1Page 8 of 20 Attachment number 1Page 9 of 20 Attachment number 1Page 10 of 20 Attachment number 1Page 11 of 20 Attachment number 1Page 12 of 20 Attachment number 1Page 13 of 20 Attachment number 1Page 14 of 20 Attachment number 1Page 15 of 20 Attachment number 1Page 16 of 20 Attachment number 1Page 17 of 20 Attachment number 1Page 18 of 20 Attachment number 1Page 19 of 20 Attachment number 1Page 20 of 20 Commission Meeting Agenda 3/17/2009 12:00 PM Condemnation Department:Attorney Caption:Motion to authorize condemnation to acquire a permanent drainage and access easement and a temporary construction easement for the AUD D’Antignac Drainage Improvements Project at the property designated as Tax Map 046-2, Parcel 120-01, 1225 Walton Way. (Approved by Engineering Services Committee March 9, 2009) Background:The City has been unable to reach a mutually acceptable agreement with the property owner. In order for the project to proceed and avoid further delays, it is necessary to condemn a portion of subject property. The required property consists of 3,718 square feet or 0.09 acre of permanent drainage and access easement and 4,313 square feet of temporary construction easement. The appraised value is $13,485.00. Analysis:Condemnation is necessary in order for the project to proceed. Financial Impact:The necessary costs will be covered under the project budget. Alternatives:Deny condemnation Recommendation:Approve condemnation. Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Law. Administrator. Clerk of Commission Cover Memo Commission Meeting Agenda 3/17/2009 12:00 PM East Augusta St & Drainage Impvts - Award CSA Department:Abie L. Ladson, PE, CPESC, Director of Engineering Caption:Motion to award Design Consultant Services Agreement to WR Toole Engineers, Inc. for the Capital Project Budget in the amount of $500,000 on the East Augusta Street and Drainage Improvements Project to be funded from SPLOST Phase III Urban Recapture Funds for the Engineering Department. (Approved by Engineering Services Committee March 9, 2009) Background:The East Augusta Street and Drainage Improvement project is an identified and partially funded project to address flooding and associated roadway improvements in the East Augusta Area bounded by East Boundary Street, the Levee, I-520 and Laney Walker Blvd. The drainage system in this area is not adequate to handle low frequency rain events, thus causing flooding several streets and yards. The Georgia Department of Transportation (GDOT) has also committed $450,000 of State-Aid to this project. Funds allocated to this project are only for design. Analysis:The following firms were evaluated based on qualifications, project approach, experience, and schedule on January 23, 2007. The following firms submitted RFQs and were evaluated: 1. ARCADIS 2. Gannett Fleming 3. EMC Engineering Services, Inc. 4. W. K. Dickerson 5. W.R. Toole Engineers, Inc. 6. Cranston Engineering Group, Inc. (Non-compliant) W.R. Toole Engineers, Inc. was selected based on the evaluation procedures used for this project. Financial Impact:Funds are available in SPLOST Phase III Urban Recapture account IMPACT: number 327-041110-6011110/296812333-6011110. Alternatives:1) Award Design Consultant Services Agreement to WR Toole Engineers, Inc. for the Capital Project Budget in the amount of $500,000 on the East Augusta Street and Drainage Improvements Project to be funded from SPLOST Phase III Urban Recapture Funds for the Engineering Department. 2) Do not approve, and risk loosing $450,000.00 of State-Aid funds. Recommendation:Approve Alternative Number One. Funds are Available in the Following Accounts: 327-041110-6011110/296812333-601111 Cover Memo REVIEWED AND APPROVED BY: Finance. Procurement. Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 13 Attachment number 1Page 2 of 13 Attachment number 1Page 3 of 13 Attachment number 1Page 4 of 13 Attachment number 1Page 5 of 13 Attachment number 1Page 6 of 13 Attachment number 1Page 7 of 13 Attachment number 1Page 8 of 13 Attachment number 1Page 9 of 13 Attachment number 1Page 10 of 13 Attachment number 1Page 11 of 13 Attachment number 1Page 12 of 13 Attachment number 1Page 13 of 13 Augusta-Richmond County, Georgia CAPITAL PROJECT BUDGET EAST AUGUSTA STREET AND DRAINAGE IMPROVEMENTS Capital Project Budget is hereby authorized: Section 1: This project is authorized to CPB#N/A. This project proposes to address flooding and associated roadway improvements in the East Augusta area bounded by East Boundary Street, the Levee, Section 2: The following revenues are anticipated to be available to the Consolidated Government to complete the project. SPLOST Urban Phase III Recapture $500,000 GDOT STATE AID CONTRACT $450,000 $950,000 Section 3: The following amounts are appropriated for the project: CPB#N/A BE IT ORDAINED by the Commission-Council of Augusta-Richmond County, Georgia that the following I-520 and Laney Walker Blvd. DO NOT PROCESS THIS DOCUMENT. (once approved by the Commission Engineering will send the original document(s) for execution to the Clerk of Commission Office. For questions please contact Engineering at ext 5070. ) Section 3: The following amounts are appropriated for the project: By Basin By District Phinizy Swamp $950,000 1st $950,000 Section 4: Copies of this Capital Project Budget shall be made available to the Comptroller for direction in carrying out this project. Adopted this ____________________ day of ______________________. Approved ____________________________________________________________ Original-Commission Council Office Copy-Engineering Department Copy-Finance Department Copy-Procurement Department Honorable Deke Copenhaver, Mayor 1 of 2 2.23.09 Attachment number 2Page 1 of 2 Augusta-Richmond County, Georgia CAPITAL PROJECT BUDGET EAST AUGUSTA STREET AND DRAINAGE IMPROVEMENTS CPB#N/A CPB AMOUNT CPB NEW SOURCE OF FUNDS CPB CHANGE CPB URBAN SPLOST PHASE III RECAPTURE 327-041110-296812333 $500,000 $500,000 GDOT STATE AID CONTRACT $450,000 $450,000 TOTAL SOURCES:$950,000 $950,000 USE OF FUNDS ENGINEERING 327-04-1110-5212115-000000000 $950,000 $950,000 TOTAL USES:$950,000 $950,000 2 of 2 2.23.09 Attachment number 2Page 2 of 2 REQUEST FOR QUALIFICATIONS Request for Qualifications will be received at this office until Tuesday, January 23, 2007 @ 3:00 p.m. FOR FURNISHING: RFQ ITEM #06-202 East Augusta Roadway and Drainage Improvements for Engineering Department RFQs will be received by: The Augusta Commission hereinafter referred to as the OWNER at the offices of: Geri A. Sams, Director Augusta Procurement Department 530 Greene Street - Room 605 Augusta, Georgia 30911 RFQ documents may be examined at the office of the Augusta, GA Procurement Department, 530 Greene Street – Room 605, Augusta, GA 30911. All questions must be submitted in writing to the office of the Procurement Department by Thursday, January 4, 2007 @ 4:00 p.m. by fax at 706-821-2811 or by mail. No RFQ will be accepted by fax, all must be received by mail or hand delivered. The local bidder preference program is applicable to this project. To be approved as a local bidder and receive bid preference on an eligible local project, the certification statement as a local bidder and all supporting documents must be submitted to the Procurement Department with your bonafide bid package. It is the wish of the Owner that minority businesses are given the opportunity to submit on the various parts of the work. This desire on the part of the Owner is not intended to restrict or limit competitive bidding or to increase the cost of the work. The Owner supports a healthy free market system that seeks to include responsible businesses and provide ample opportunity for business growth and development. No RFQ may be withdrawn for a period of 60 days after time has been called on the date of opening. Bidders will please note that the number of copies requested; all supporting documents including financial statements and references and such other attachments that may be required by the bid invitation are material conditions of the bid. Any package found incomplete or submitted late shall be rejected by the Procurement Office. Any bidder allegedly contending that he/she has been improperly disqualified from bidding due to an incomplete bid submission shall have the right to appeal to the appropriate committee of the Augusta Commission. Please mark RFQ number on the outside of the envelope. Bidders are cautioned that sequestration of RFQ documents through any source other than the office of the Procurement Department is not advisable. Acquisition of RFQ documents from unauthorized sources places the bidder at the risk of receiving incomplete or inaccurate information upon which to base his qualifications. Augusta has a Link Deposit program designed to provide loans to eligible local Small, Minority and Women Owned Businesses. For more information about this program, please contact the Office of the Disadvantage Business Enterprise at 706-821-2406. GERI A. SAMS, Procurement Director Publish: Augusta Chronicle December 7, 14, 21, 28, 2006 Metro Courier December 13, 2006 cc: Tameka Allen Interim Deputy Administrator Abie Ladson Engineering Robert Oliver Engineering Yvonne Gentry DBE Coordinator Attachment number 3Page 1 of 1 Vendor Original Five (5) copies Fee Addendum # 1 ARCADIS, 2849 Paces Ferry Rd. Suite 400, Atlanta, GA 30339 Yes Yes Yes Yes Gannett Fleming, Bldg 100, Suite 120, 2743 Perimeter Parkway, Augusta, GA 30909- 0555 Yes Yes Yes Yes EMC Engineering Services, Inc., 23 East Charlton St., P O Box 8101, Savannah, GA 31412 Yes Yes Yes Yes Mabus Brothers, 920 Molly Pond Rd., Augusta, GA 30901 Wolverton and Associates, Inc. 6745 Sugarload Parkway, Suite 100, Duluth, GA 30097 W. K. Dickson, 1450 Greene St., Suite 225, Augusta, GA 30901 Yes Yes Yes Yes W. R. Toole, 349 Greene St., Augusta, GA 30901 Yes Yes Yes Yes Cranston Engineering Group, 452 Ellis St., Augusta, GA 30901 Yes Yes Yes No* Jordan, Jones and Goulding, 6801 Governors Lake Pkway, Bldg 200, Norcross, GA 30071 *Cranston Engineering, non- compliant for not acknowledging receipt of addendum # 1 with RFQ RFQ #06-202 East Augusta Roadway and Drainage Improvements Engineering Department RFQ due: Tuesday, January 23, 2007 @ 3:00 pm Attachment number 4Page 1 of 2 Attachment number 4Page 2 of 2 EMC Engineering Services, Inc. 23 East Charlton Street Savannah, GA 31412 Attn: Mark Mobley Cranston Robertson Whitehurst 452 Ellis Street Augusta, GA 30903 Attn: Dennis Welch W. K. Dickson & Co. 1640 Powers Ferry Rd. Bldg. 11 Suite 100 Marietta, GA 30067 Attn: Donald Hawksley ZEL Engineers 435 Telfair Street Augusta, GA 30901 Attn: Jorge Jimenez Attachment number 5Page 1 of 1 MEMORANDUM DATE: February 26, 2007 TO: Abie L. Ladson FROM: Geri A. Sams SUBJECT: Summary Scoring Sheet – RFQ # 06-202 East Augusta Roadway and Drainage Improvements –RFQ due date: January 23, 2007 3:00 p.m. Attached please find the Summary Scoring Sheet for the above request for qualification. Please note that the highest scoring vendor is W. R. Toole with a total average of 34.67. Please ensure that the Procurement Department is in the workflow so we may attach the required documentation when the agenda item is being submitted with the recommended vendor through the MuniAgenda system for approval by the Board of Commission. GAS/bc Attachment (as indicated) Attachment number 6Page 1 of 1 Re q u e s t f o r Q u a l i f i c a t i o n #0 6 - 2 0 2 Ea s t A u g u s t a R o a d w a y a n d D r a i n a g e I m p r o v e m e n t s En g i n e e r i n g D e p a r t m e n t Du e D a t e : 1 / 2 3 / 0 7 3 : 0 0 P M EV A L U A T I O N S H E E T AR C A D I S GA N N E T T F L E M I N G EM C W. K . D I C K S O N TO O L E QU A L I F I C A T I O N S St a t e o f G e o r g i a L i c e n s e E n g i n e e r s t o P r o j e c t In d i v i d u a l ( s ) h a v e e x p e r i e n c e w i t h s i m i l a r p r o j e c t s Qu a l i f i e d s t a f f t o p e r f o r m t e s t r e s e a r c h a n d ca l c u l a t i o n s De s c r i b e s t a f f ’ s u n i q u e q u a l i f i c a t i o n s a n d t r a i n i n g fo r t h i s t y p e o f w o r k 24 2 7 2 9 2 7 2 6 AP P R O A C H T O P R O J E C T De s c r i b e t h e a p p r o a c h t o t h i s p r o j e c t , s p e c i a l id e a s a n d t e c h n i q u e s 20 2 5 1 9 2 3 2 5 EX P E R I E N C E De s c r i b e t h e e x p e r i e n c e o f f i r m a n d / o r in d i v i d u a l s a s s i g n e d t o s i m i l a r p r o j e c t s 21 2 6 2 3 2 6 2 4 SC H E D U L E De s c r i b e t h e a n t i c i p a t e d w o r k h o u r s n e c e s s a r y t o co m p l e t e t h i s p r o j e c t Pr o v i d e s c h e d u l e f o r t h e w o r k w i l l b e c o m p l e t e d 20 1 7 1 3 2 4 2 9 TO T A L R A W S C O R E S 85 9 5 8 4 1 0 0 1 0 4 AV E R A G E S C O R E S ( 3 ) E V A L U A T O R S 28 . 3 4 31 . 6 7 28 33 . 3 4 34 . 6 7 Attachment number 7Page 1 of 1 Commission Meeting Agenda 3/17/2009 12:00 PM Norfolk Southern-1108126 Deed of Easement Department:Augusta Utilities Department Caption:Motion to approve and accept a Deed of Easement from Norfolk Southern, NS Activity #1108126. (Approved by Engineering Services Committee March 9, 2009) Background:The Augusta Utilities Department project 60107 - Butler Creek Interceptor Upgrade East, Phase 1, requires a railroad crossing near Marvin Griffin Road. Norfolk Southern is the owner of this track. Analysis:Norfolk Southern has agreed to enter into an easement agreement with Augusta, for the railroad crossing. Financial Impact:$5,000 for the crossing plus a $1,000 Risk Financing Fee (supplemental insurance) Alternatives:Deny the motion to approve and accept the easement agreement. Recommendation:Approve and accept the Deed of Easement from Norfolk Southern. Funds are Available in the Following Accounts: 510043420-5411120 80260107-5411120 REVIEWED AND APPROVED BY: Finance. Procurement. Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 6 Attachment number 1Page 2 of 6 Attachment number 1Page 3 of 6 Attachment number 1Page 4 of 6 Attachment number 1Page 5 of 6 Attachment number 1Page 6 of 6 Commission Meeting Agenda 3/17/2009 12:00 PM Norfolk Southern-1108127 Deed of Easement Department:Augusta Utilities Department Caption:Motion to approve and accept a Deed of Easement from Norfolk Southern, NS Activity #1108127. (Approved by Engineering Services Committee March 9, 2009) Background:The Augusta Utilities Department project 60108 - Butler Creek Interceptor Upgrade, Phase 2, requires a railroad crossing near Phinizy Road. Norfolk Southern is the owner of the tracks. Analysis:Norfolk Southern has agreed to enter into an easement agreement with Augusta. Financial Impact:$5,000 for the crossing and $1,000 for a Risk Financing Fee (supplemental insurance) Alternatives:Deny the motion to approve and accept a Deed of Easement with Norfolk Southern. Recommendation:Approve and accept the Deed of Easement from Norfolk Southern. Funds are Available in the Following Accounts: 510043420-5411120 80260108-5411120 REVIEWED AND APPROVED BY: Finance. Procurement. Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 6 Attachment number 1Page 2 of 6 Attachment number 1Page 3 of 6 Attachment number 1Page 4 of 6 Attachment number 1Page 5 of 6 Attachment number 1Page 6 of 6 Commission Meeting Agenda 3/17/2009 12:00 PM Southern Region Industrial Realty Easement Deed Department:Augusta Utilities Department Caption:Motion to approve an Easement Deed from Southern Region Industrial Realty, Inc. (Approved by Engineering Services Committee March 9, 2009) Background:The Augusta Utilities Department has future plans to replace the Butler Creek Interceptor AUD Project #60107). In order to construct this project, an easement is needed from Southern Region Industrial Realty. Analysis:The property in question is the parcel at the southerneastern corner of Marvin Griffin Road and Doug Barnard Parkway. Southern Region Industrial Realty (SRIR) is a subsidiary of Norfolk Southern. There are no railroad facilities on this property. The easement was appraised and that is the amount indicated in the Easement Deed. Financial Impact:$17,561.00 Alternatives:Deny motion to approve an Easement Deed from Southern Region Industrial Realty, Inc. Recommendation:Approve motion to approve an Easement Deed from Southern Region Industrial Realty, Inc. Funds are Available in the Following Accounts: G/L 511043420-5411120 J/L 80360107-5411120 REVIEWED AND APPROVED BY: Finance. Procurement. Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 5 Attachment number 1Page 2 of 5 Attachment number 1Page 3 of 5 Attachment number 1Page 4 of 5 Attachment number 1Page 5 of 5 Attachment number 2Page 1 of 5 Attachment number 2Page 2 of 5 Attachment number 2Page 3 of 5 Attachment number 2Page 4 of 5 Attachment number 2Page 5 of 5 Commission Meeting Agenda 3/17/2009 12:00 PM Wilkinson Garden Area Roadway Drainage Impvts - CPB/Award CSA Department:Abie L. Ladson, PE, CPESC, Director of Engineering Caption:Motion to approve Capital Project Budget Change Number One and Award Design Consultant Services Agreement to W.K. Dickson and Co., Inc. in the amount of $328,735.00 for the Wilkinson Garden Area Roadway Drainage Improvements Project (CPB# 323-041110-204823525). Funds of $291,180.00 are to be used from the Project Engineering Account, and $37,555.00 from Phase III Recapture to fully fund the Design Phase for the Engineering Department. (Approved by Engineering Services Committee March 9, 2009) Background:An identified and partially funded project to address flooding and associated roadway improvements in the Wilkinson Garden Area was approved by the Augusta-Richmond Commission on February 17, 2004. The drainage system in the area is not adequate to handle low frequency rain events, thus causing flooding along several roadways and yards. A report was completed in December 2005 to study both the hydrology and hydraulics in the area. Funds allocated to this project are only for design. Analysis:The following firms were evaluated based on qualifications, project approach, experience, and schedule on April 17, 2007. The following firms submitted RFQs and were evaluated: 1. LPA Group 2. ZEL Engineers (Non- compliant) 3. EMC Engineering Services, Inc. 4. W.K. Dickson & Co., Inc. 5. W.R. Toole Engineers, Inc. 6. Cranston Engineering Group, Inc. W.K. Dickson & Co., Inc. was selected based on the evaluation procedures used for this project. Financial Impact:Funds are available in Phase III Recapture account 323-041110- 6011110/296823333-6011110 to be transferred to the project engineering account. Alternatives:1) Approve Capital Project Budget Change Number One and Award Design Consultant Services Agreement to W.K. Dickson and Co., Inc. in the amount of $328,735.00 for the Wilkinson Garden Area Roadway Drainage Improvements Project (CPB# 323-04-204823525). Funds of $291,180.00 are to be used from the Project Engineering Account, and $37,555.00 from Phase III Recapture to fully fund the Design Phase for the Engineering Department. 2) Do not approve. Recommendation:approve alternative one Funds are Available in Cover Memo the Following Accounts:323-041110-6011110/296823333-6011110 REVIEWED AND APPROVED BY: Finance. Procurement. Law. Administrator. Clerk of Commission Cover Memo Attachment number 1Page 1 of 14 Attachment number 1Page 2 of 14 Attachment number 1Page 3 of 14 Attachment number 1Page 4 of 14 Attachment number 1Page 5 of 14 Attachment number 1Page 6 of 14 Attachment number 1Page 7 of 14 Attachment number 1Page 8 of 14 Attachment number 1Page 9 of 14 Attachment number 1Page 10 of 14 Attachment number 1Page 11 of 14 Attachment number 1Page 12 of 14 Attachment number 1Page 13 of 14 Attachment number 1Page 14 of 14 REQUEST FOR QUALIFICATIONS Request for Qualifications will be received at this office until Tuesday, April 17, 2007 @ 3:00 p.m. FOR FURNISHING: RFQ ITEM #07-113 Rock Creek/Warren Lake Restoration Project for Augusta Engineering RFQ Item #07-114 Wilkinson Garden Area Roadway and Drainage Improvements for Augusta Engineering RFQs will be received by: The Augusta Commission hereinafter referred to as the OWNER at the offices of: Geri A. Sams, Director Augusta Procurement Department 530 Greene Street - Room 605 Augusta, Georgia 30911 RFQ documents may be examined at the office of the Augusta, GA Procurement Department, 530 Greene Street – Room 605, Augusta, GA 30911. All questions must be submitted in writing to the office of the Procurement Department by Tuesday, March 27, 2007@ 4:00 p.m. by fax at 706-821-2811 or by mail. No RFQ will be accepted by fax, all must be received by mail or hand delivered. The local bidder preference program is applicable to this project. To be approved as a local bidder and receive bid preference on an eligible local project, the certification statement as a local bidder and all supporting documents must be submitted to the Procurement Department with your bonafide bid package. It is the wish of the Owner that minority businesses are given the opportunity to submit on the various parts of the work. This desire on the part of the Owner is not intended to restrict or limit competitive bidding or to increase the cost of the work. The Owner supports a healthy free market system that seeks to include responsible businesses and provide ample opportunity for business growth and development. No RFQ may be withdrawn for a period of 60 days after time has been called on the date of opening. Bidders will please note that the number of copies requested; all supporting documents including financial statements and references and such other attachments that may be required by the bid invitation are material conditions of the bid. Any package found incomplete or submitted late shall be rejected by the Procurement Office. Any bidder allegedly contending that he/she has been improperly disqualified from bidding due to an incomplete bid submission shall have the right to appeal to the appropriate committee of the Augusta Commission. Please mark RFQ number on the outside of the envelope. Bidders are cautioned that sequestration of RFQ documents through any source other than the office of the Procurement Department is not advisable. Acquisition of RFQ documents from unauthorized sources places the bidder at the risk of receiving incomplete or inaccurate information upon which to base his qualifications. GERI A. SAMS, Procurement Director Publish: Augusta Chronicle March 1, 8, 15, 22, 2007 Metro Couriers March 7, 2007 cc: Tameka Allen Interim Deputy Administrator Abie Ladson Engineering ` Robert Oliver Engineering Yvonne Gentry DBE Coordinator Attachment number 2Page 1 of 1 Ve n d o r s : Or i g i n a l 5 C o p i e s Ad d e n d u m 1 Qu a l i f i c a t i o n s Ap p r o a c h to Pr o j e c t Ex p e r i e n c e Sc h e d u l e To t a l Po i n t s 10 To o l e E n g i n e e r s 34 9 4 t h S t r e e t Au g u s t a , G A 3 0 9 0 1 X X X 8 . 7 5 8 . 2 5 8 . 2 5 6 . 5 0 7 . 9 3 MS T C o m p a n y P. O . B o x 9 9 1 Fa i r b u r n , G A 3 0 2 1 3 EM C E n g i n e e r i n g P. O . B o x 8 1 0 1 Sa v a n n a h , G A 3 1 4 1 2 X X X 7 . 7 5 7 . 2 5 7 . 2 5 5 . 2 5 6 . 8 7 CE W 36 6 A u g u s t a A v e . At l a n t a , G A 3 0 3 1 5 W. K . D i c k s o n 14 5 0 G r e e n S t r e e t , S u i t e 2 2 5 Au g u s t a , A 3 0 9 0 9 X X X 8 . 5 0 8 . 5 0 8 . 2 5 7 . 0 0 8 . 0 6 Cr a n s t o n E n g i n e r r i n g C o . 45 2 E l l i s S t . Au g u s t a , G A 3 0 9 0 1 X X X 7 . 5 0 6 . 2 5 7 . 7 5 5 . 7 5 6 . 8 1 LP A G r o u p 70 0 H u g e r S t . Co l u m b i a , S C 2 9 2 0 1 X X X 6 . 7 5 6 . 0 0 6 . 2 5 4 . 7 5 5 . 9 3 Ze l l E n g i n e e r s 43 5 T e l f a i r S t . Au g u s t a , G A 3 0 9 0 1 X X N O AP P R O A C H T O P R O J E C T De s c r i b e t h e a p p r o a c h t o t h i s p r o j e c t , s p e c i a l i d e a s a n d t e c h n i q u e s EX P E R I E N C E De s c r i b e t h e e x p e r i e n c e o f f i r m a n d / o r i n d i v i d u a l s a s s i g n e d to s i m i l a r p r o j e c t s SC H E D U L E De s c r i b e t h e a n t i c i p a t e d w o r k h o u r s n e c e s s a r y t o c o m p l e t e th i s p r o j e c t Pr o v i d e s c h e d u l e f o r t h e w o r k w i l l b e c o m p l e t e d SC O R I N G Ex c e l l e n t G o o d F a i r P o o r 10 t o 8 7 t o 5 4 t o 3 2 t o 0 QU A L I F I C A T I O N S St a t e o f G e o r g i a L i c e n s e E n g i n e e r s t o P r o j e c t In d i v i d u a l ( s ) h a v e e x p e r i e n c e w i t h s i m i l a r p r o j e c t s Qu a l i f i e d s t a f f t o p e r f o r m t e s t r e s e a r c h a n d c a l c u l a t i o n s De s c r i b e s t a f f ’ s u n i q u e q u a l i f i c a t i o n s a n d t r a i n i n g f o r t h i s ty p e o f w o r k RF Q # 0 7 - 1 1 4 E v a l u a t i o n S h e e t Wi l k i n s o n G a r d e n A r e a R o a d w a y & D r a i n a g e I m p r o v e m e n t s - A u g u s t a E n g i n e e r i n g D e p a r t m e n t Tu e s d a y , A p r i l 1 7 , 2 0 0 7 @ 3 : 0 0 p . m . Attachment number 3Page 1 of 1 Ve n d o r s : Or i g i n a l 5 C o p i e s Ad d e n d u m 1 Qu a l i f i c a t i o n s Ap p r o a c h to Pr o j e c t Ex p e r i e n c e Sc h e d u l e To t a l Po i n t s 10 To o l e E n g i n e e r s 34 9 4 t h S t r e e t Au g u s t a , G A 3 0 9 0 1 X X X 8 . 7 5 8 . 2 5 8 . 2 5 6 . 5 0 7 . 9 3 MS T C o m p a n y P. O . B o x 9 9 1 Fa i r b u r n , G A 3 0 2 1 3 EM C E n g i n e e r i n g P. O . B o x 8 1 0 1 Sa v a n n a h , G A 3 1 4 1 2 X X X 7 . 7 5 7 . 2 5 7 . 2 5 5 . 2 5 6 . 8 7 CE W 36 6 A u g u s t a A v e . At l a n t a , G A 3 0 3 1 5 W. K . D i c k s o n 14 5 0 G r e e n S t r e e t , S u i t e 2 2 5 Au g u s t a , A 3 0 9 0 9 X X X 8 . 5 0 8 . 5 0 8 . 2 5 7 . 0 0 8 . 0 6 Cr a n s t o n E n g i n e r r i n g C o . 45 2 E l l i s S t . Au g u s t a , G A 3 0 9 0 1 X X X 7 . 5 0 6 . 2 5 7 . 7 5 5 . 7 5 6 . 8 1 LP A G r o u p 70 0 H u g e r S t . Co l u m b i a , S C 2 9 2 0 1 X X X 6 . 7 5 6 . 0 0 6 . 2 5 4 . 7 5 5 . 9 3 Ze l l E n g i n e e r s 43 5 T e l f a i r S t . Au g u s t a , G A 3 0 9 0 1 X X N O AP P R O A C H T O P R O J E C T De s c r i b e t h e a p p r o a c h t o t h i s p r o j e c t , s p e c i a l i d e a s a n d t e c h n i q u e s EX P E R I E N C E De s c r i b e t h e e x p e r i e n c e o f f i r m a n d / o r i n d i v i d u a l s a s s i g n e d to s i m i l a r p r o j e c t s SC H E D U L E De s c r i b e t h e a n t i c i p a t e d w o r k h o u r s n e c e s s a r y t o c o m p l e t e th i s p r o j e c t Pr o v i d e s c h e d u l e f o r t h e w o r k w i l l b e c o m p l e t e d SC O R I N G Ex c e l l e n t G o o d F a i r P o o r 10 t o 8 7 t o 5 4 t o 3 2 t o 0 QU A L I F I C A T I O N S St a t e o f G e o r g i a L i c e n s e E n g i n e e r s t o P r o j e c t In d i v i d u a l ( s ) h a v e e x p e r i e n c e w i t h s i m i l a r p r o j e c t s Qu a l i f i e d s t a f f t o p e r f o r m t e s t r e s e a r c h a n d c a l c u l a t i o n s De s c r i b e s t a f f ’ s u n i q u e q u a l i f i c a t i o n s a n d t r a i n i n g f o r t h i s ty p e o f w o r k RF Q # 0 7 - 1 1 4 E v a l u a t i o n S h e e t Wi l k i n s o n G a r d e n A r e a R o a d w a y & D r a i n a g e I m p r o v e m e n t s - A u g u s t a E n g i n e e r i n g D e p a r t m e n t Tu e s d a y , A p r i l 1 7 , 2 0 0 7 @ 3 : 0 0 p . m . Attachment number 4Page 1 of 1 ENGINEERING DEPARTMENTENGINEERING DEPARTMENTENGINEERING DEPARTMENTENGINEERING DEPARTMENT Abie L. Ladson, P.E., Robert L. Oliver, Jr. Director Interim Asst Director Engineering Department 1815 Marvin Griffin Road, Augusta, GA 30906 Office: (706) 796-5040, Fax: (706) 796 -5045 www.augustaga.gov MEMORANDUM TO: Geri Sams, Procurement Director THRU: Abie L. Ladson, P.E., Director FROM: Robert L. Oliver, Jr., Interim Assistant Director DATE: Tuesday, May 22, 2007 SUBJECT: Wilkinson Garden Area Roadway and Drainage Project (RFQ) Project Number: 323-04-20482325 Bid Number: 07-114 File Ref #: 07-014(A) Ms. Sams, it is the recommendation of the Engineering Department to award the RFQ for Wilkinson Garden Area Roadway and Drainage Project to W.K. Dickson. If you have any question or concerns, please do not hesitate to contact me at (706) 796-5040. RLO/scm cc: Anthony (Tony) E. Williams, Construction Manager File Attachment number 5Page 1 of 1 Toole Engineers 349 – 4th Street Augusta, GA 30901 Atn: Rick Toole Toole Engineers 349 – 4th Street Augusta, GA 30901 Atn: Rick Toole Toole Engineers 349 – 4th Street Augusta, GA 30901 Atn: Rick Toole MST Company P. O. Box 991 Fairburn, GA 30213 MST Company P. O. Box 991 Fairburn, GA 30213 MST Company P. O. Box 991 Fairburn, GA 30213 EMC Engineering P. O. Box 8101 Savannah, GA 31412 Atn: Thomas A. Ferrara EMC Engineering P. O. Box 8101 Savannah, GA 31412 Atn: Thomas A. Ferrara EMC Engineering P. O. Box 8101 Savannah, GA 31412 Atn: Thomas A. Ferrara CEW 366 Augusta Avenue Atlanta, GA 30315 Atn: Revonda Cosby CEW 366 Augusta Avenue Atlanta, GA 30315 Atn: Revonda Cosby CEW 366 Augusta Avenue Atlanta, GA 30315 Atn: Revonda Cosby W. K. Dickson 1450 Greene Street Ste 225 Augusta, GA 30909 Atn: Joe Holley W. K. Dickson 1450 Greene Street Ste 225 Augusta, GA 30909 Atn: Joe Holley W. K. Dickson 1450 Greene Street Ste 225 Augusta, GA 30909 Atn: Joe Holley Cranston Robertson Whitehurst 452 Ellis Street Augusta, GA 30901 Atn: Dennis Welch Cranston Robertson Whitehurst 452 Ellis Street Augusta, GA 30901 Atn: Dennis Welch Cranston Robertson Whitehurst 452 Ellis Street Augusta, GA 30901 Atn: Dennis Welch Abie Ladson Engineering Robert Oliver Engineering RFQ 07-114 Addendum 1 mailed certified/return receipt 3/27/07 Attachment number 6Page 1 of 1 Commission Meeting Agenda 3/17/2009 12:00 PM Minutes Department:Clerk of Commission Caption:Motion to approve the minutes of the regular meeting of the Commission held on March 3, 2009. Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Commission Meeting Agenda 3/17/2009 12:00 PM Appointment Board of Health Department: Caption:Motion to approve the appointment of W. Stuart Flanagin to the seat held by Eugene Hunt on the Richmond County Board of Health. (Requested by Commissioner Jerry Brigham) Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Attachment number 1Page 1 of 2 Attachment number 1Page 2 of 2 Commission Meeting Agenda 3/17/2009 12:00 PM Appointment District 7 Department: Caption:Motion to approve the appointment of Mr. Randy Sasser to the Augusta Aviation Commission due to the resignation of Mr. Jim Jatho and Mr. Roy Rearden to the unexpired term of Mr. Sasser on General Aviation Commission representing District 7. Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Attachment number 1Page 1 of 1 Attachment number 2Page 1 of 2 Attachment number 2Page 2 of 2 Commission Meeting Agenda 3/17/2009 12:00 PM Report from Administrator Department:Administrator Caption:Motion to receive an report update from the Administrator. Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Cover Memo Commission Meeting Agenda 3/17/2009 12:00 PM SPLOST Phase VI Department:Administrator Caption:Motion to approve a Resolution for Tax Anticipation Note to be paid through the Local Option Sales Tax (SPLOST) Phase VI . Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Cover Memo Commission Meeting Agenda 3/17/2009 12:00 PM Canal Department: Caption:Update on the Augusta Canal Cleanup. (Requested by Commissioner Joe Bowles) Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo Commission Meeting Agenda 3/17/2009 12:00 PM Affidavit Department: Caption:Motion to authorize execution by the Mayor of the affidavit of compliance with Georgia's Open Meeting Act. Background: Analysis: Financial Impact: Alternatives: Recommendation: Funds are Available in the Following Accounts: REVIEWED AND APPROVED BY: Clerk of Commission Cover Memo